SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024590 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000024590
Domain Number - Region: 82-165
Classification Level Classification E-value
Superfamily PUG domain-like 0.00183
Family PUG domain 0.016
Further Details:      
 
Domain Number - Region: 466-513
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0181
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024590   Gene: ENSGGOG00000027397   Transcript: ENSGGOT00000031258
Sequence length 533
Comment pep:known_by_projection chromosome:gorGor3.1:20:47809499:47821663:-1 gene:ENSGGOG00000027397 transcript:ENSGGOT00000031258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSHGGDKVAPLDRMGKPSSMDTKFKDDLFRKYVQFHESKVDTTTSRQRSGSDECLRVAAS
TLLSLHKVDPFYRFRLIQFYEVVESSLRSLRSSSLRALHGAFSMLETVGINLFLYPWKKE
FRSIKTYTGPFVYYVKSTLLEEDIRAILSCMGYAPELGTAYKLRELVEILQVKMVSFELF
LAKVECEQMLEIHSQVKDKGYSELDIVSERKSSAEDVRGCSDALRRRAEGREHLTASMSR
VALQKSASERAAKDYYKPRVTKPSRSVDAYDSYWESRKPPLKASLSLRKEPVATDVGDDL
KDEIIRPSPSLLTMASSPHGSPDALPPASPSNGPGLLRGTYFSTQDDVDLYTDSEPRAAY
RRQDALRPDVWLLRNDAHSLYHKRSPPAKESALSKCQSCGLSCSSSLCQRCDSLLTCPPA
SKPSAFPSKASTHDSLAHGASLREKYPGQTQGLDRLPHLHSKSKPSTTPTSRCGFCNRPG
ATNTCTQCSKVSCDACLSAYHYDPCYKKSELHKFMPNNQLNYKSTQLSHLVYR
Download sequence
Identical sequences ENSGGOP00000024590 ENSGGOP00000024590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]