SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024591 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024591
Domain Number 1 Region: 9-299
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.12e-81
Family Eukaryotic proteases 0.00057
Further Details:      
 
Domain Number 2 Region: 431-543
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.22e-29
Family Spermadhesin, CUB domain 0.00085
Further Details:      
 
Domain Number 3 Region: 318-420
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-22
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024591   Gene: ENSGGOG00000001085   Transcript: ENSGGOT00000027512
Sequence length 564
Comment pep:known_by_projection chromosome:gorGor3.1:11:7737342:7752525:-1 gene:ENSGGOG00000001085 transcript:ENSGGOT00000027512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLISRNKLILLLGIVFFERGESATLSLPKAPSCGQSLVKVQHWNYFNIFSRILGGSQVEK
GSYPWQVSLKQRQKHICGGSIVSPQWVITAAHCVANRNIVSTLNVTAGEYDLSQTDPGEQ
TLTIETVIIHPHFSTKKPMDYDIALLKMAGAFQFGHFVGPICLPELREQFEAGLICTTAG
WGRLTEGGVLSQVLQEVNLPILTWEECAAALLTLKRPISGKTFLCTGFPDGGRDACQGDS
GGSLMCRNKKGAWTLAGVTSWGLGCGRGWRNNVRKSDQGSPGIFTDLSKVLPWIHEHIQT
GNQRKSSRAWCSEQDVIVSGAEGKLHFPESLHLYYESEQQCVWTLLVPEEMHVLLSFSHL
DVESCHHNYLSMYSLEDRPIGKFCGESLPSSILVGSNSLRLKFVSDATDYEAGFNLTYKA
LKPNYIPDSGCSYLTVLFEEGLIQSLNYPENYSDKANCDWIFQAPKHHLIKLSFQSLEIE
ESGDCTSDYVTVHSDVERKKEIARLCGYDVPTPVLSPSSIMLISFQSDENGTFRGFQATV
SFIPKAGKKIESPTLWLPVLILVM
Download sequence
Identical sequences ENSGGOP00000024591 ENSGGOP00000001070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]