SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024596 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024596
Domain Number 1 Region: 7-322
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.33e-56
Family beta-N-acetylhexosaminidase catalytic domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024596   Gene: ENSGGOG00000001583   Transcript: ENSGGOT00000033423
Sequence length 489
Comment pep:known_by_projection chromosome:gorGor3.1:5:714992:737706:-1 gene:ENSGGOG00000001583 transcript:ENSGGOT00000033423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSTPFKMRLVHLDLKGAPPKVSYLSEIFPLFRALGANGLLIEYEDMFPYEGPLRLLRA
KYAYSASEIKEILHLAGLNELEVIPLVQTFGHMEFVLKHTAFAHLREVGSFPCTLNPHEA
ESLALVGAMIDQVLELHPGAQRLHVGCDEVYYLGEGEASRRWLQQEQNSTGKLCLSHMRA
VASRVKARRPSVTPLVWDDMLRELPEDQLAASGVPQLVEPVLWDYAADLDVHGKVLLMQK
YRRCGFPWLWAASAFKGATGPSQAVPPVEHHLRNHVQWLQVAGSGPTDSLQGIILTGWQR
YDHYSVLCELLPAGVPSLAACLQLLLRGGFDEDVKAKVENLLGISSLEITDPVREGAGSF
PGSNILALVTQVSLHLRSSVDALLEGNDRCWYVTGWFSPYHRQRKLIHPVMVQHIQPAAL
SLLAQWSTLVQELEAALQLAFYPDAVEEWLEENVHPSLQRLQALLQDLSEVSAPPLPPTS
PSRDTAQDP
Download sequence
Identical sequences ENSGGOP00000024596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]