SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024626 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024626
Domain Number 1 Region: 195-360
Classification Level Classification E-value
Superfamily RNI-like 1.24e-41
Family 28-residue LRR 0.00000709
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000024626
Domain Number - Region: 444-537
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00107
Family Formin homology 2 domain (FH2 domain) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024626   Gene: ENSGGOG00000004684   Transcript: ENSGGOT00000030113
Sequence length 552
Comment pep:known_by_projection chromosome:gorGor3.1:7:121706258:121714691:1 gene:ENSGGOG00000004684 transcript:ENSGGOT00000030113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTFGYRRGLSKYESIDEDELLASLSAEELKELERELEDIEPDCNLPVGLRQKSLTEKTP
TGTFSREALMAYWEKESQKLLEKERLGECGKVAEDKEESEEELIFTESNSEVSEEVYTEE
EEEESQEEEEEEDSDEEERTIETAKGINGTVNYDSVNSDNSKPKIFKSQIENINLTNGSN
GRNTDSPAAIHPCGNPTVIEDALDKIKSNDSDTTEVNLNNIENITTQTLTRFAEALKDNT
VVKTFSLANTHADDSAAMAIAEMLKVNEHITNVNVESNFITGKGILAIMRALQHNTVLTE
LRFHNQRHIMGSQVEMEIVKLLKENTTLLRLGYHFELPGPRMSMTSILTRNMDKQRQKRL
QEQKQQEGYDGGPNLRTKVWQRGTPSSSPYVSPRHSPWSSPKLPKKVQTVRSRPLSPVAT
PPPPPPPPPPPXXXPPPSSSQRLPPPPPPPPPPLPEKKLITRNIAEVIKQQESAQRALQN
GQKKKKGKKVKKQPNSILKEIKNSLRSVQEKKMEDSSRPSTPQRSAHENLMEAIRGSSIK
QLKRVEVPEALR
Download sequence
Identical sequences ENSGGOP00000004588 ENSGGOP00000024626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]