SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024638 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024638
Domain Number 1 Region: 53-131
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 9.16e-29
Family Cytochrome b5 0.0029
Further Details:      
 
Domain Number 2 Region: 373-518
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 9.69e-27
Family Reductases 0.01
Further Details:      
 
Domain Number 3 Region: 267-383
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.34e-20
Family Ferredoxin reductase FAD-binding domain-like 0.00078
Further Details:      
 
Domain Number 4 Region: 167-256
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.00000000000000785
Family GS domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024638   Gene: ENSGGOG00000002913   Transcript: ENSGGOT00000027909
Sequence length 521
Comment pep:known_by_projection chromosome:gorGor3.1:6:83853125:83956749:1 gene:ENSGGOG00000002913 transcript:ENSGGOT00000027909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNVPSQSFPAPRSQQRVASGGRSKVPLKQGRSLMDWIRLTKSGKDLTGLKGRLIEVTEE
ELKKHNKKDDCWICIRGFVYNVSPYMEYHPGGEDELMRAAGSDGTELFDQVHRWVNYESM
LKECLVGRMAIKPAVLKDYREEEKKVLNGMLPKSQVTDTLAKEGPSYPSYDWFQTDSLVT
IAIYTKQKDINLDSIIVDHQNDSFRAETIIKDCLYLIHIGLSHEVQEDFSVRVVESVGKI
EIVLKKKENISWDFLGHPLKNHNSLIPRKDTGLYYRKCQLISKEDVTHDTRLFCLMLPPS
THLQVPIGQHVYLKLPNTGTGIVKPYTPVSGSLLSEFKEPVLPNNKYIYFLIKIYPTGLF
TPELDRLQIVNFVNIGNPEGNFKISKFQELEDLFLLAAGTGFTPMVKILNYALTDIPSLR
KVKLMFFNKTEDDIIWRSQLEKLAFKDKRLDVEFVLSAPISEWNGKQGHISPALLSEFLK
RNLDKSKVLVCICGPVPFTEQGVRLLHDLNFSKNEIHSFTA
Download sequence
Identical sequences ENSGGOP00000024638 ENSGGOP00000024638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]