SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024674 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024674
Domain Number 1 Region: 262-329
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000852
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 2 Region: 45-68
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000144
Family CCCH zinc finger 0.0047
Further Details:      
 
Domain Number 3 Region: 196-221
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000144
Family CCCH zinc finger 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000024674
Domain Number - Region: 76-97
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00106
Family CCCH zinc finger 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024674   Gene: ENSGGOG00000024940   Transcript: ENSGGOT00000032502
Sequence length 361
Comment pep:novel chromosome:gorGor3.1:X:41459613:41462182:1 gene:ENSGGOG00000024940 transcript:ENSGGOT00000032502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACLGGRTAAGNFGARALSAAAAAVSPTPIPTVTAPSPRAGGGWTKQVTCRYFKYGICKEG
DNCRYSHDLSDRLCGVVCKYFQRGCCVYGDRCRCEHSKPLKQEEAPATELTTKSSLAASS
SLSSIVGPLVEMNTNEAESRNSNFATVVAGSEDWANAIEFVPGQPYCGRTVPSCTEAPLQ
GSVTKEESEEEQTAVETKKQLCPYAAVGQCRYGENCVYLHGDLCDMCGLQVLHPMDAAQR
SQHIQACTEAHEKDMEFSFAVQRSKDKVCGICMEVIYEKANPNEHRFGILSNCNHTFCLK
CIRKWRSAKEFESRIVKSCPQCRITSNFVIPSEYWVEEKEEKQKLIQKYKEAMSDKACKY
F
Download sequence
Identical sequences ENSGGOP00000024674 ENSGGOP00000024674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]