SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024676 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024676
Domain Number 1 Region: 327-584
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.47e-99
Family STAT DNA-binding domain 0.0000603
Further Details:      
 
Domain Number 2 Region: 136-332
Classification Level Classification E-value
Superfamily STAT 1.79e-54
Family STAT 0.00019
Further Details:      
 
Domain Number 3 Region: 1-124
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 1.07e-39
Family Transcription factor STAT-4 N-domain 0.00035
Further Details:      
 
Domain Number 4 Region: 585-702
Classification Level Classification E-value
Superfamily SH2 domain 1.08e-33
Family SH2 domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024676   Gene: ENSGGOG00000008216   Transcript: ENSGGOT00000027550
Sequence length 782
Comment pep:known_by_projection chromosome:gorGor3.1:5:41768212:41910658:1 gene:ENSGGOG00000008216 transcript:ENSGGOT00000027550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNN
SSSHLEDYSGLSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVYSKYYTPVPSKAVDGYVKPQIKQVVPEFVNASADAGGGSATY
MDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQWIPHA
QS
Download sequence
Identical sequences ENSGGOP00000024676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]