SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024690 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024690
Domain Number 1 Region: 10-258
Classification Level Classification E-value
Superfamily Carbonic anhydrase 3.4e-97
Family Carbonic anhydrase 0.000000000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024690   Gene: ENSGGOG00000027324   Transcript: ENSGGOT00000032425
Sequence length 259
Comment pep:known_by_projection chromosome:gorGor3.1:8:83896840:83914870:1 gene:ENSGGOG00000027324 transcript:ENSGGOT00000032425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDSHVFFPPGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQAASLRILN
NGHSFNVEFDDSQDKAVLKGGPLEGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLV
HWNTKYGDFGKAVQQPDGLAVLGIFLKVGSTKPGLQKVVDVLDSIKTKGKSADFTNFDPR
GLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQMLKFRKLNFNGEGEPEELMV
DNWRPAQPLKNRQIKASFK
Download sequence
Identical sequences G3S9C4
ENSGGOP00000024690 ENSGGOP00000024690 XP_004047268.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]