SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024699 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024699
Domain Number 1 Region: 187-298
Classification Level Classification E-value
Superfamily Fibronectin type III 7.22e-16
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 2 Region: 40-147
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000902
Family Formin homology 2 domain (FH2 domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024699   Gene: ENSGGOG00000026946   Transcript: ENSGGOT00000022261
Sequence length 341
Comment pep:known_by_projection chromosome:gorGor3.1:9:87603950:87668433:1 gene:ENSGGOG00000026946 transcript:ENSGGOT00000022261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSQKYCFKENENVTVDKACFLISNITIGPESINLQQEALQRIISTLANKNDEIQNFIDT
LHHTLKGVQENSSNILSELDEEFDSLYSILDEVKESMINCIKQEQARKSQELQSQISQCN
NALENSEELLEFATRSLDIKEPEEFSKAARQIKDRVTMASAFRLSLKPKVSDNMTHLMVD
FSQERQMLQTLKFLPVPKAPEIDPVECLVADNSVTVAWRMPEEDNKIDHFILEHRKTNFD
GLPRVKDERCWEIIDNIKGTEYTLSGLKFDSKYMNFRVRACNKAVAGEYSDPVTLETKAL
NFNLDNSSSHLNLKVEDTCVEWDPTGGKGQESKIKGKENKG
Download sequence
Identical sequences ENSGGOP00000024699 ENSGGOP00000024699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]