SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024718 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024718
Domain Number 1 Region: 69-145
Classification Level Classification E-value
Superfamily HMG-box 5.24e-27
Family HMG-box 0.000059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024718   Gene: ENSGGOG00000008531   Transcript: ENSGGOT00000032907
Sequence length 366
Comment pep:novel chromosome:gorGor3.1:8:10364866:10369693:-1 gene:ENSGGOG00000008531 transcript:ENSGGOT00000032907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NQGPGRGCGPRDAPPVRRACPARRSEATACGHGFAAGSTLGPRVSSARPWTPSCRMDNPG
RPPAPGGGSESRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALTLSQKR
PYVDEAERLRLQHMQDYPNYKYRPRRKKQAKRLCKRVDPLPPELPLPGPERPAGEEKRQP
GTPPALPCPASGLLPRGAGCGGPYGLPTPPEMSPLDVLEPEQTFFFPLPGGAWPSPPHPP
PARAPVLTGVPQALYCSHWAPALASPPASPCPLYPAVPHYYSPATYHPHLGQLSPPPAPW
LRRPGSIEPVELLGDMDRNEFDQYLNCTQTPPQGPWPSSQVTRVPETSLISVLADATATY
YNSCVI
Download sequence
Identical sequences ENSGGOP00000024718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]