SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024739 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024739
Domain Number 1 Region: 719-799
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000249
Family HLH, helix-loop-helix DNA-binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024739   Gene: ENSGGOG00000022345   Transcript: ENSGGOT00000026613
Sequence length 919
Comment pep:known_by_projection chromosome:gorGor3.1:12:121969062:122011973:1 gene:ENSGGOG00000022345 transcript:ENSGGOT00000026613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAADVFMCSPRRPRSRGRQVLLKPQVSEDDDDSDTDEPSPPPASGAATPARAHASAAPPP
PRAGPGREEPPRRQQIIHSGHFMVSSPHREHPPKKGYDFDTVNKQTCQTYSFGKTSSCHL
SIDASLTKLFECMTLAYSGKLVSPKWKNFKGLKLQWRDKIRLNNAIWRAWYMQYLEKRKN
PVCHFVTPLDGSVDVDEHRRPEAITTEGKYWKSRIEIVIREYHKWRTYFKKRLQQHKDED
LSSLVQDDDMLYWHKHGDGWKTPVPMEEDPLLDTDMLMSEFSDTLFSTLSSHQPVAWPNP
REIAHLGNADMIQPGLIPLQPNLDFMDTFEPFQDLFSSSRSIFGSMLPASASAPVPDPNN
PPAQESILPTTALPTVSLPDSLIAPPTAPSLAHMDGQGCEHTSRTEDPFIQPTDFGPSEP
PLSVPQPFLPVFTMPLLSPSPAPPPISPVLPLVPPPATALNPPAPPTFHQPQKFAGVNKA
PSVITHTASATLTHDAPATTFSQSQGLVITTHHPAPSAAPCGLALSPVTRPPQPRLTFVH
PKPVSVTGGRPKQPHKIVPAPKPEPVSLVLKNARIAPAAFSGQPQAVIMTSGPLKREGML
ASTVSQSNVVIAPAAIARAPGVPEFHSSILVTDLGHGTSSPPAPVSRLFPGTAQDPLGKG
EQVPLHGGSPQVTVTGPSRDCPNSGQASPCASEQSPSPQSPQNNCSGKSDPKNVAALKNR
QMKHISAEQKRRFNIKMCFDMLNSLISNNSKLTSHAITLQKTVEYITKLQQERGQMQEEA
RRLREEIEELNATIISCQQLLPATGVPVTRRQFDHMKDMFDEYVKSRTLQNWKFWIFSII
IKPLFESFKGMVSTSSLEELHRTALSWLDQHCSLPILRPMVLSTLRQLSTSTSILTDPAQ
LPEQASKAVTRIGKRLGES
Download sequence
Identical sequences G3S9H3
ENSGGOP00000024739 XP_018894568.1.27298 ENSGGOP00000024739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]