SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024740 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000024740
Domain Number - Region: 16-101
Classification Level Classification E-value
Superfamily Rhomboid-like 0.0837
Family Rhomboid-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024740   Gene: ENSGGOG00000027122   Transcript: ENSGGOT00000032993
Sequence length 133
Comment pep:known_by_projection chromosome:gorGor3.1:16:56707405:56729166:1 gene:ENSGGOG00000027122 transcript:ENSGGOT00000032993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLSFITFICYVASSASAFLTAPLLEFLLALYFLFADAMQLNDKWQGLCWPMMDFLRCVTA
ALIYFAISITAVAKYSDGASKAAGVFGFFATIVFAIDFYLIFNDVAKFLKQGDSADETTA
HKTEEENSDSDSD
Download sequence
Identical sequences ENSNLEP00000004839 ENSNLEP00000004839 ENSGGOP00000024740 9598.ENSPTRP00000042675 ENSPTRP00000042675 ENSPTRP00000042675 ENSGGOP00000024740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]