SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024746 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024746
Domain Number 1 Region: 27-269,337-387
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.78e-91
Family Type II chitinase 0.0000001
Further Details:      
 
Domain Number 2 Region: 269-336
Classification Level Classification E-value
Superfamily Chitinase insertion domain 2.29e-24
Family Chitinase insertion domain 0.0000797
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024746   Gene: ENSGGOG00000016018   Transcript: ENSGGOT00000027520
Sequence length 390
Comment pep:known_by_projection chromosome:gorGor3.1:1:114175870:114213034:1 gene:ENSGGOG00000016018 transcript:ENSGGOT00000027520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGATTMDQKSLWAGVVVLLLLQGGSAYKLVCYFTNWSQDRQEPGKFTPENIDPFLCSHLI
YSFASIENNKVIIKDKSEVMLYQTINSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTS
RSEFINSVILFLRNHNFDGLDVSWIYPDQKENTHFTVLIHELAEAFQKDFTKSTKERLLL
TAGVSAGRQMIDNSYQVEKLAKDLDFINLLSFDFHGSWEKPLITGHNSPLSKGWQDRGPS
SYYNVEYAVGYWIHKGMPSEKVVMGIPTYGHSFTLASAETTVGAPASGPGAAGPITESSG
FLAYYEICQFLKGAKITRLQDQQVPYAVKGNQWVGYDDVKSMETKVQFLKNLNLGGAMIW
SIDMDDFTGKSCNQGPYPLVQAVKRSLGSL
Download sequence
Identical sequences G3RIW0
XP_004026377.1.27298 ENSGGOP00000015627 ENSGGOP00000024746 ENSGGOP00000015627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]