SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024754 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024754
Domain Number 1 Region: 14-362
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.83e-139
Family Calpain large subunit, catalytic domain (domain II) 0.00000000000884
Further Details:      
 
Domain Number 2 Region: 366-525
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 3.27e-57
Family Calpain large subunit, middle domain (domain III) 0.0000000751
Further Details:      
 
Domain Number 3 Region: 532-712
Classification Level Classification E-value
Superfamily EF-hand 4.83e-47
Family Penta-EF-hand proteins 0.00000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024754   Gene: ENSGGOG00000007754   Transcript: ENSGGOT00000027375
Sequence length 714
Comment pep:known_by_projection chromosome:gorGor3.1:11:62030629:62061139:1 gene:ENSGGOG00000007754 transcript:ENSGGOT00000027375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEEIITPVYCTGVSAQVQKQRARELGLGRHENAIKYLGQDYEQLRVRCLQSGTLFRDEA
FPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHS
AEGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILK
ALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAKQVNYRGQMVSLIRMRNPWGE
VEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLEICNLTPDALKS
RTIRKWNTTLYEGTWRRGSTAGGCRNYPTTFWVNPQFKIRLDETDDPDDYGDRESGCSFV
LALMQKHRRRERRFGRDMETIGFAVYEVPPELVGQPAVHLKRDFFLANASRARSEQFINL
REVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTAELDDQIQANLPDEQVLSE
EEIDENFKALFRQLAGEDMEISVKELRTILNRIISKHKDLRTKGFSLESCRSMVNLMDRD
GNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELII
TRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
Download sequence
Identical sequences ENSGGOP00000024754 ENSGGOP00000024754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]