SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024763 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024763
Domain Number 1 Region: 90-196
Classification Level Classification E-value
Superfamily C-type lectin-like 1.4e-23
Family C-type lectin domain 0.0000132
Further Details:      
 
Domain Number 2 Region: 52-81
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.000085
Family Triple coiled coil domain of C-type lectins 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024763   Gene: ENSGGOG00000025123   Transcript: ENSGGOT00000033294
Sequence length 198
Comment pep:novel chromosome:gorGor3.1:10:92340807:92343343:-1 gene:ENSGGOG00000025123 transcript:ENSGGOT00000033294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGPSGEKGDPDQGLRGLQGPPGKLGPPGNTGAPGIPGPSSQKGDHGDNSVAEAKLANLER
ELQSLRSELDHTKKLQAFSLGKMSGKKLSVTNSEWMPFSKVKNLCAGFQATVAAPKNAKE
NKAIQDVAKDTAFLGITDGTNKGQFLYVTGGRLTYSNWKKDEPDDHGSGEDRMILLKDRL
WNDISCASCFLAICEFTA
Download sequence
Identical sequences ENSGGOP00000024763 ENSGGOP00000024763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]