SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024783 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024783
Domain Number 1 Region: 91-198
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000451
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 2 Region: 500-563,597-628
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000822
Family Second domain of FERM 0.0072
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000024783
Domain Number - Region: 392-487
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000165
Family Ras-binding domain, RBD 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024783   Gene: ENSGGOG00000013802   Transcript: ENSGGOT00000025026
Sequence length 768
Comment pep:known_by_projection chromosome:gorGor3.1:5:41362735:41371847:1 gene:ENSGGOG00000013802 transcript:ENSGGOT00000025026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPGGLWWLLCCRRGFTLLHRDYGDGELSGDGDEDEDEETFELRTPSPAGGGRGPLEVT
LTQPVRSGPVSNRLQSWEETWSLIPEKGLPEDDPDIVVKGWLYREPRGGGARPWLPPRRA
WFVLTRDSLDQFSSSGKGARRLGSLVLTSLCSVTGPERRRKETGLWSVTVSGRKHSVRLC
SPRQAEAERWGVALREVIASKAPLETPTQLLLRDIQESCGDPEAVALIYLRNPILRHTSG
ALYAPLLPLPYGVSAPGPGYAPLREEAVRLFLALQALVMQGVLQTCRDLPALRDELFLQL
AKQTSGPAGPPGLPATQDPAALRYWQLLTCMSCTFRPGGAVRGHLLGHLERTEQALPDSE
LAEYARFIRKALGRTRGRELVPSLAEISALSQRRELLCTVHCPGAGACAVAIDSHTTAGE
VARELVGRLGLARSRNAFALYEQRGAQERALAGGTLVADVLTRFENLAAEEAGLEDSPDS
GWRLCLRLHGPLHPEGLSPDGHELPFLFEQAHALLLRGRPPPPDDTLRALAALRLQSLHR
DFSPRVPLPRLDRLLPPREDPPRPTPRPPPSAALLAGALWSPGLAKTAGSIAREGGGGAG
TAAAVLGGWKRLRGMGRAEAMAAYLALAAQCPGFGAARYDVLELSTEPGGGAPQKLCLGL
GAKAMSLSRPGETEPIHSVSYGHVAACQLMGPHTLALRVGESQLLLQSPQVEEIMQLVNA
YLANPSPERPCSSSSPPCQDLPDTSPPSQCPGLDEPQGQSGCLGQLQD
Download sequence
Identical sequences ENSGGOP00000024783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]