SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024789 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024789
Domain Number 1 Region: 157-244
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000537
Family Canonical RBD 0.012
Further Details:      
 
Domain Number 2 Region: 4-47
Classification Level Classification E-value
Superfamily NTF2-like 0.00000589
Family NTF2-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024789   Gene: ENSGGOG00000022952   Transcript: ENSGGOT00000029822
Sequence length 270
Comment pep:known_by_projection chromosome:gorGor3.1:5:135699488:135715678:1 gene:ENSGGOG00000022952 transcript:ENSGGOT00000029822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMEKPSPLLVGREFVRQYYTLLNQAPDMLHGSVANKFYVHNDIFRYQDEVFGGFVTEPQ
EESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEP
VSEIQEEKPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLREFETSYGNVVELRINSGGK
LPNFGFVVFDDSEPVQKVLSNRPIMFRGEVRLNVEEKKTRAAREGDRRDNRLRGPGGPRG
GLGGGMRGPPRGGMVQKPGFGVGRGLAPRQ
Download sequence
Identical sequences ENSGGOP00000024789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]