SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024796 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024796
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.0000000000158
Family beta-Galactosidase/glucuronidase domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024796   Gene: ENSGGOG00000026568   Transcript: ENSGGOT00000024527
Sequence length 93
Comment pep:novel chromosome:gorGor3.1:6:27722649:27729404:-1 gene:ENSGGOG00000026568 transcript:ENSGGOT00000024527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVNYQISVKCSNQFKLEVCLLNAENKVVDSQAGTQGQLKVGANFWWPYLMHEHPAYLYSW
ESVCGCDPCEQLLLLVSQLRAPGVDSAAAGRPV
Download sequence
Identical sequences ENSGGOP00000024796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]