SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024802 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024802
Domain Number 1 Region: 17-95
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000421
Family PDZ domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024802   Gene: ENSGGOG00000026177   Transcript: ENSGGOT00000027941
Sequence length 4409
Comment pep:known_by_projection chromosome:gorGor3.1:11:59296079:59326557:-1 gene:ENSGGOG00000026177 transcript:ENSGGOT00000027941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKEEETTRELLLPNWQGSGSHGLTITQRDDGVFVQEVTQNSPAARTGVVKEGDQIVGAT
IYFDNLQSGEVTQLLNTMGHHTVGLKLHRKGDRSPEPGQTWTREVFSSRSSEVVLSGDDE
EYQRIYTTKIKPRLKSEDGVEGDLGETQSRTITVTRRVTAYTVDVTGREGAKDIDISSPE
FKIKIPRHELTEISSVDVETQSGKTVIRLPSGSGAASPTGSAVDIRAGAISASGPELQGA
GHSKLQVTMPGIKVGGSGVNVSAKGLDLGGRGGVQVPAVDISSSLGGRAVEVQGPSLESG
DHGKIKFPTMKVPKFGVSTGREGQTPEAGLRVSAPEVSVGHKGGKPGLTIQAPQLEVSVP
SANIEGLEGKLKGPQITGPSLEGDLGLKGAKPQGHIGVDASAPQIGGSITGPSVEVQAPD
IDVQGPGSKLNVPKMKVPKFSVSGGKGEETGIDVTLPTGEVTVPGVSGDVSLPEIATGGL
EGKMKGTKVKTPEMIIQKPKISMQDVDLSLGSPKLKGDIKVSAPGVQGDVKGPQVALKGS
RVDIETPNLEGTLTGPRLGSPSGKTGTCRISMSEVDLNVAAPKVKGGVDVTLPKVEGKVK
VPEVDVKGPKVDVSAPDMPGFKGEGPEVDVNLPQADIDVSGPKVDVEVPDVSLEGPEGKV
KGPKFKMPEMHFKAPKISMPDVDLNLKGPKLKGDVDVSLPDVEGEMKVPDVDIKGPKVDI
SAPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVKLPKADVDVSGPKMDAEVPDVN
IEGPDAKLKGPKFKMPEMSIKPQKISIPDVGLHLKGPKMKGDYDVTVPKVEGEIKAPDVD
IKGPKVDINAPDVEVHGPDWHLKMPKMKMPKFSVPSLKGEGPEVDVNLPKADIDVSGPGV
DIDAPDLDIEGPEGKLKGSKFKMPKLNIKAPKVSMPDVDLNLKGPKLKGEIDASVPELEG
DLRGPQVDVKGPFVEAEVPDVDLECPDAKLKGPKFKMPEMHFKAPKISMPDVDLHLKSPK
VKGDANVSLPKLEGDLTGPSVDVEVPDVELECPDAKLKGPKFKMPDMHFKAPKISMPDVD
LHLKGPKVKGDADVSLPKLEGDLTGPSVGVEVPDVDLECPDAKLKGSKFKMPEMHFKTPK
ISMPDVDLHLKGPKVKGDMDVSVPKVEGEMKVPDVDIKGPKMDIDAPDVDVHGEGPEVDV
NLPKADVDVSGPKLDVEVPDVSLEGPEGKLKGPKFKMPEMHFKTPKISMPDVDFNLKGPK
IKGDVDVSAPKLEGELKGPELDVKGPKLDADMPEVAVEGPNGKWKTPKFKMPDMHFKAPK
ISMPDLDLHLKSPKAKGEVDVDVPKLEGDLKGPHVDVSGPDIDIEGPEGKLKGPKFKMPD
MHFKAPNISMPDVDLNLKGPKIKGDVDVSVPEVEGKLEVPDMNIRGPKVDVNAPDVQGPD
WHLKMKMPEMNIKAPKISMPDLDLNLKGPKMKGEVDVSLPNVEGDLKGPALDIKGPKIDV
DAPDIDIHGPDAKLKGPKLKMPDMHVNMPKISMPEIDLNLKGSKLKGDVDVSGPKLEGDI
KAPSLDIKGPEVDVSGPKLNIEGKSKKSRFKLPKFNFSGSKVQTPEVDVKGKKPDIDITG
PKVDINAPDVEVQGKVKGSKFKMPFLSISSPKVSMPDVELNLKGPKVKGDLDIAGPNLEG
DFKGPKVDIXMKMPKFSVPGLKAEGPDVAVDLPKGDINIEGPSMNIEGPDLNVESPEGGL
KGPKFKMPDMNIKAPKISMPDIDLNLKGPKVKGDVDISLPKLEGDLKGPEVDIKGPKVDI
SAPDVDVRGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVTLPRADIDISGPIVDVDVPDVN
IEGPDAKLKGPKFKMPEMNIKVPKISMPDFDLNLKGPKMKGDVDVSLPKVEGDLKGPEVD
IKGPKVDIDTPDINIEGPEGKFKGPKFKIPEMHLKAPKISMPDIDLNLKGPKVKGDVDVS
LPKVEGDLKGPEVDIKGPKVDIDAPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPDVDV
NLPKADLDVSGPKVDIDVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPK
VKGDMDVSLPKVEGDMKVPDVDIKGPKVDINAPDVDVQGPDWHLKMPKMKMPKFSMPGFK
AEGPEVDVNLPKADVDVSGPKVDVEGPDVNIEGPEGKLKGPKFKMPEMNIKAPKICMPDF
DLHLKGPKVKGDVDASLPKVEGDLKGPEVDIRGPKLDIDVPDVDVQGPDWHLKMPKVKMP
KFSMPGFKGEGPDVDVNLPKADLDVSGPKVDIDVPDVNIEGPEGKLKGPKFKMPEMNIKA
PKISMPDFDLHLKGPKVKGDVDVSLPKMEGDLKTPEVDIKGPKVDIDAPDVDVHGPDWHL
KMPKVKMPKFSMPGFKGEGPEVDVNLPKADIDVSGPKVDIDTPDIDIHGPEGKLKGPKFK
MPDLHLKAPKISMPEVDLNLKGPKMKGDVDVSLPKVEGDLKGPEVDIKGPKVDIDVPDVD
VQGPDWHLKMPKVKMPKFSMPGFKGEGPELDVNLPKADLDVSGPKVDIDVPDVNIEGPDA
KLKGPKFKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLPKVEGDLKGPEVDIKGPKV
DINAPDVGVQGPDWHLKMPKMKMPKFSMPGFKGEGPDVDMKLPKADIDVSGPKVAIEGPD
VNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDVDVSLPKVEGDLKGPE
ADIKGPKVDIDAPDVDVHGPDWHLKMPKIKMPKISMPGFKGEGPDVDVNLPKADLDVSGP
KVDIECPDVNIEGPEGKWKSPKFKMPEMHFKTPKISMPDIDLNLTGPKIKGDVDVTGPKV
EGDLKGPEVDLKGPKVDXIKAPKISMPDIDFNLKGPKVKGDVDVSLPKVEGDLKGPEIDI
KGPSLDIDTADVNIESPEGKLKGPKFKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSL
PKVEGDLKGPEVDIEGPEGKLKGPKFKMPDVHFKTPQISMSDIDLNLKGPKIKGDMDISI
PKLEGDLKGPKVDVKGPKVDIDTPDIDIHGPEGKLKGPKFKMPDLHLKAPKISMPEVDLN
LKGPKVKGDMDISLPKVEGELKGPEVDIRGPKVDIDVPDVDVQGPDWHLKMPKVKMPKFS
MPGFKGEGPELDVNLPKADIDVSGPKVDIDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKI
SMPDIDLNLKGPKVKGDVDVTLPKVEGDLKGPEADIKGPKVDINAPDVDVHGPDWHLKMP
KVKMPKFSMPGFKGEGPDVDVSLPKADIDVSGPKVDVDVPDVNIEGPDAKLKGPKFKMPE
MNIKAPKISIPDVDLDLKGPKVKGDFDVSVPKVEGTLKGPEVDLKGPRLDFEGPDAKLSG
PSLKMPSLEISAPKVTAPDVDLHLKAPKIGFSGPKLEGGEVDLKGPKVEAPSLEVHMDSP
DINIEGPDVKIPKFKKPKFGFGAKSPKADIKSPSLDVTVPEAELNLETPEISVGGKGKKS
KFKMPKIHMSGPKIKAKKQGFDLNVPGGEIDASLKAPDVDVNIAGPDAALKVDVKSPKTK
KTMFGKMYFPDVEFDIKSPKFKAEAPLPSPKLEGEFQAPDLELSSPAIHVEGLDIKAKAP
KVKMPDVDISVPKIEGDLKGPKVQANLGAPDINIEGLDAKVKTPSFGISAPQVSIPDVNV
NLKGPKIKGDVPSVGLEGPDVDLQGPEAKIKFPKFSMPKIGVPGVKMEGWGAEVHAQLPS
LEGDLRGPDVKLEGPDVSLKGPGVDLPSVNLSMPKVSGPDLDLNLKGPSLKGDLDASVPS
MKVHAPGLNLSGVGGKMQVGGDGVKVPGIDATTKLNVGAPDVTLRGPSLQGDLGVSGDIK
CPKVSVGAPDLSLEASEGSIKLPKMKLPQFGISTPGSDLHVNAKVPQVSGELKGPGVDVN
LKGPQISAPNVDFNLEGPKVKGSLGATGEIKGPTVGGGLPGISVQGLEGNLQMPGIKSSG
CDVNLPGVNVKLPTGQISGPEIKGGLKGSEVGFHGAAPDIGVKGPSFNMASPESDFGINL
KGPKIKGGADVSGGVSAPDISLGEGHLSVKGSGGEWKGPQVSSALNLDTSKFAGGLHFSG
PKVEGGVKGGQIELQAPGLSVSGPQGHLESGSGKVTFPKMKIPKFTFSGRELVGREVGVD
VHFPKAEASIQAGAGDGEWEESEVKLKKSKIKMPKFNFSKPKGKGGVTGSPEASISGSKG
DLKSSKASLGSLEGEAEAEASSPKGKFSLFKSKKPRHRSNSFSDEREFSGPSTPTGTLEF
EGGEVSLEGGKVKGKHGKLKFGTFGGLGSKSKGHYEVTGSDDETGKLQGSGVSLASKKSR
LSSSSSNDSGNKVGIQLPEVELSVSTKKE
Download sequence
Identical sequences ENSGGOP00000024802 ENSGGOP00000024802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]