SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024803 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024803
Domain Number 1 Region: 450-817
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 8.37e-94
Family Hect, E3 ligase catalytic domain 0.00000547
Further Details:      
 
Domain Number 2 Region: 67-171
Classification Level Classification E-value
Superfamily E set domains 0.0000000028
Family Filamin repeat (rod domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024803   Gene: ENSGGOG00000008612   Transcript: ENSGGOT00000034234
Sequence length 824
Comment pep:known_by_projection chromosome:gorGor3.1:14:55930470:55979651:-1 gene:ENSGGOG00000008612 transcript:ENSGGOT00000034234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYVIGGITVSVVAFFFTIKFLFELAARVVSFLQNEDRERRGDRTIYDYVRGNYLDPRSC
KVSWDWKDPYEVGHSMAFRVHLFYKNGQPFPAHRPVGLRVHISHVELAVEIPVTQEVLQE
PNSNVVKVAFTVRKAGRYEITVKLGGLNVAYSPYYKIFQPGRMVVPSKTKIVCHFSTLVL
TCGQPHTLQIVPRDEYDNPTNNSMSLRDEHNYTLSIHELGPQEEESTGVSFEKSVTSNRQ
TFQVFLRLTLHSRGCFHACISYQNQPINNGEFDIIVLSEDEKNIVERNVSTSGVSIYFEA
YLYNATNCSSTPWHLPPMHMTSSQRRPSTAVDEEDEDSPSECHTPEKVKKPKKVYCYVSP
KQFSVKEFYLKIIPWRLYTFRVCPGTKFSYLGPDPVHKLLTLVVDDGIQPPVELSCKERN
ILAATFIRSLHKNIGGSETFQDKVNFFQRELRQVHMKRPHSKVTLKVSRHALLESSLKAT
RNFSISDWSKNFEVVFQDEEALDWGGPRREWFELICKALFDTTNQLFTRFSDNNQALVHP
NPNRPTHLRLKMYEFAGRLVGKCLYESSLGGAYKQLVRARFTRSFLAQIIGLRMHYKYFE
TDDPEFYKSKVCFILNNDMSEMELVFAEEKYNKSGQLDKVVELMTGGAQTPVTNANKIFY
LNLLAQYRLASQVKEEVEHFLKGLNELVPENLLAIFDENELEEPRLLRLSLGSSCLWLEC
IILYSYWEKKKKVMRWFWTVVSSLTQEELARLLQFTTGSSQLPPGGFAALCPSFQIIAAP
THSTLPTAHTCFNQLCLPTYDSYEEVHRMLQLAISEGCEGFGML
Download sequence
Identical sequences ENSGGOP00000024803 ENSGGOP00000008421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]