SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024810 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024810
Domain Number 1 Region: 118-266
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.99e-29
Family Dual specificity phosphatase-like 0.0000779
Further Details:      
 
Domain Number 2 Region: 2-143
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.000046
Family Cell cycle control phosphatase, catalytic domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024810   Gene: ENSGGOG00000003152   Transcript: ENSGGOT00000003167
Sequence length 324
Comment pep:novel chromosome:gorGor3.1:1:208826169:208827241:1 gene:ENSGGOG00000003152 transcript:ENSGGOT00000003167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLGCRPYLAFTTLSVPGSLNINLYSVVCASPGRLWGQRATCCQMPRSTLLLQEGSRHGQ
KLREESAQRVVLTSLLACLPSCWRIYFLKGGYETFFQGCMDVKLVSLVSNQCGKLVVLNI
NYRPAYDQDGPVEILSFLYLGGAYHASKCKFLIKLHITAQLNVPLWSLQDPPTYKWILVE
EGHMADISSHFQEAIDFIDCVREKKGKVLVHREAGFSCSPTICMAYLIKTKHFCLKEAFN
YVKWKRSMISPSFGFMGQLLRPNPQLPSYQGEAAGSSLISHLQTFSPDLKGVYCTFPASV
LAPVPTHWTVSELSRSPVATATFC
Download sequence
Identical sequences ENSGGOP00000024810 ENSGGOP00000024810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]