SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024818 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024818
Domain Number 1 Region: 33-329
Classification Level Classification E-value
Superfamily L domain-like 9.75e-59
Family Ngr ectodomain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 396-694
Classification Level Classification E-value
Superfamily L domain-like 5.19e-54
Family Ngr ectodomain-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024818   Gene: ENSGGOG00000013462   Transcript: ENSGGOT00000031651
Sequence length 762
Comment pep:known_by_projection chromosome:gorGor3.1:22:25575968:25587552:-1 gene:ENSGGOG00000013462 transcript:ENSGGOT00000031651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGPRSSTHVSLVLPLLVLLLLAPARQAAAQRCPQACICDNSRRHVACRHQNLTEVPDAI
PELTQRLDLQGNLLKVIPAAAFQGVPHLTHLDLRHCQVELVAEGAFRGLGRLLLLNLASN
HLRELPQEALDGLGSLRRLELEGNALEELRPGTFGALGALATLNLAHNALVYLPAMAFQG
LLRVRWLRLSHNALSVLAPEALAGLPALRRLSLHHNELQALPGPVLSQARGLARLELGHN
PLTYAGEEDGLALPGLRELLLDGGALQALGPRAFAHCPRLHTLDLRGNQLDTLPPLQGPG
QLRRLRLQGNPLWCGCQARPLLEWLARARVRSDGACQGPRRLRGEALDALRPWDLRCPGD
AAQEEEELEERAVAGPRAPPRGPPRGPGEERAVAPCPRACVCVPESRHSSCEGCGLQAVP
RGFPNDTQLLDLRRNHFPSVPRAAFPGLGHLVSLHLQHCGIAELEAGALAGLGRLIYLYL
SDNQLAGLSTAALEGAPRLGYLYLERNRFLQVPGAALRALPSLFSLHLQDNAVDRLAPGD
LGGTRALRWVYLSGNRITEVSLGALGPARELEKLHLDRNQLREVPTGALEGLPALLELQL
SGNPLRALRDGAFQPVGRSLQHLFLNSSGLEQICPGAFSGLGPGLQSLYLQKNQLRALPA
LPSLSQLELIDLSSNPFHCDCQLLPLHRWLTGLNLRVGATCATPPNARGQRVKAAAAVFE
ACPGWAARKAKRTPASRPSARRTPIKGRQRGADKVGKEKGRL
Download sequence
Identical sequences G3S9Q0
ENSGGOP00000024818 ENSGGOP00000013132 XP_004063578.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]