SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024831 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000024831
Domain Number - Region: 2-22
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000334
Family CCCH zinc finger 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024831   Gene: ENSGGOG00000001038   Transcript: ENSGGOT00000028410
Sequence length 448
Comment pep:known_by_projection chromosome:gorGor3.1:7:23450646:23469358:1 gene:ENSGGOG00000001038 transcript:ENSGGOT00000028410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAICQFFLQGRCRFGDRCWNEHPGARGVGVGRQQPQQQPSGNNRRGWNTTSQRYSNVIQP
SSFSKSTPWGGSRDQEKPYFSSFDSGASTNRKAGFGLSENPFASLSPDEQKDEKKFLEGI
VKDMEVWESSGQWMFSVYSPVKKKPNISGFTDISPEELRLEYHNFLTSNNLQSYLNSVQR
LINQWRNRVNELKSLNISTKVALKCLWKIYTHLSPKIYGPDCGKFIIFLSDVKDGVNQAA
PAFGFGSSQAATFMSPGFPVNNSSSDNAQNFSFKTNSGFAAASSGSPAGFGSSPAFGAAA
STSSGISTSAPAFGFGKPEVTSAASFSFKSPAASSFGSPGFSGLPTSLATGPVRAPVAPA
FGGGSSVAGFGSPGSHSHTAFSKPSSDTFGNSSISTSLSASSSIIATDNVLFTPRDKLTV
EELEQFQSKKFTLGKIPLKPPPLELLNI
Download sequence
Identical sequences XP_004045216.1.27298 ENSGGOP00000001022 ENSGGOP00000024831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]