SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024839 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024839
Domain Number 1 Region: 31-163
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-23
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 2 Region: 233-352
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000135
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024839   Gene: ENSGGOG00000000467   Transcript: ENSGGOT00000000467
Sequence length 757
Comment pep:known_by_projection chromosome:gorGor3.1:11:63200528:63202801:-1 gene:ENSGGOG00000000467 transcript:ENSGGOT00000000467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLRLLLAWAAAGPTLGQDPWAAEPRAACGPGSCYALFPRRRTFLEAWRACRELGGDLAT
PRTPEEAQRVDSLVGAGPASRLLWIGLQRQARQCQLQRPLRGFTWTTGDQDTAFTNWAQP
ASGGPCPAQRCVALEASGEHRWLEGSCTLAVDGYLCQFGFEGACPALQDEAGQAGPAVYT
TPFHLVSTEFEWLPFGSVAAVQCQAGRGASLLCVKQPEGGVGWSRAGPLCLGTGCSPDNG
GCEHECVEEVDGHVSCRCTEGFRLAADGRSCEDPCAQAPCEQQCEPGGPQGYSCHCRLGF
RPAEDDPHRCVDTDECQIAGVCQQMCVNYVGGFECYCSEGHELEADGISCSPAGAMGAQA
SQDLGDELLDDGEDEEDEDEAWKAFNGGWTEMPGILWMEPTQPPDFALAYRPSFPEDREP
QIPYPEPTWPPPLSAPRVPYHSSVLSVTRPVVVSATRPTLPSAHQPPVIPATHPALSRDH
QISVIAANYPDLPSAYQPGILSVSHPAQPPAHQPPMISTKYPELFPAHQSPMFPDTRVAG
TQTTTHLPGIPPNHAPLVTTLGAQLPPQAPDAPVLRTQATQLPIIPTAQPSLTTTSRSPV
SPAHQISVPAATQPAALPTLLPSQSPTNQTSPISPTHPHSKAPQIPREDGPSPKLALWLP
SPAPTAAPTALGEAGLAEHSQRDDRWLLVALLVPTCIFLVVLLALGIVYCTRCGPHAPNK
RITDCYRWVTHAGSKSPTEPMPPRGSLTGVQTCRTSV
Download sequence
Identical sequences G3S9S1
ENSGGOP00000024839 ENSGGOP00000024839 XP_004051625.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]