SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024872 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024872
Domain Number 1 Region: 498-648
Classification Level Classification E-value
Superfamily EF-hand 1.75e-50
Family Osteonectin 0.00000203
Further Details:      
 
Domain Number 2 Region: 443-495
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000347
Family Ovomucoid domain III-like 0.00054
Further Details:      
 
Domain Number 3 Region: 416-440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000424
Family Follistatin (FS) module N-terminal domain, FS-N 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024872   Gene: ENSGGOG00000015425   Transcript: ENSGGOT00000032570
Sequence length 649
Comment pep:known_by_projection chromosome:gorGor3.1:4:96431668:96487943:-1 gene:ENSGGOG00000015425 transcript:ENSGGOT00000032570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTGLFFLCLLGTAAAIPTNARLLADHSKPTAETVAPDNTAIPSLRAEDEENEKETAVST
EDDSHRKAEKSSVLKSKEESHGQSAEQGKSSSQELGLKDQEDSDGDLSVNLEYAPTEGTL
DIKEDMSEPQEKKLSENTDFLAPDVSSFTDSNQQESITKREENQEQPRNYSHHQLNRSSK
HSQGLRDQGNQEQDPNISNGEEEEEKEPDEVGTHNDNQERKTELPREHANSKQEEDNTQS
DDILEESDQPTQVSKMQEDEFDLSNQEQEDNSNAEMEEENASNVNKHIQETEWQSQEGKT
GLEAISNHKETDEKTVSEVLLMEPTDDGNTMSRNHGGPRHSASDDYFIPSQAFLEAERAQ
SIAYHLKIEEQREKVHENENIGTSEPGEHQEAKKAENSSNEEETSSEGNMRVHGVDSCMS
FQCKRGHICKADQQGKPHCVCQDPVTCPPTKPLDQVCGTDNQTYASSCHLFATKCRLEGT
KKGHQLQLDYFGACKSIPTCTDFEVIQFPLRMRDWLKNILMQLYEANSEHAGYLNEKQRN
KVKKIYLDEKRLLAGDHPIDLLLRDFKKNYHMYVYPVHWQFSELDQHPMDRVLTHSELAP
LRASLVPMEHCITRFFEECDPNKDKHITLKEWGHCFGIKEEDIDENLLF
Download sequence
Identical sequences ENSGGOP00000024872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]