SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024901 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024901
Domain Number 1 Region: 323-437
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-31
Family SPRY domain 0.00061
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-16
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 85-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000321
Family B-box zinc-binding domain 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000024901
Domain Number - Region: 165-248
Classification Level Classification E-value
Superfamily NAP-like 0.0288
Family NAP-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024901   Gene: ENSGGOG00000024492   Transcript: ENSGGOT00000029527
Sequence length 437
Comment pep:novel chromosome:gorGor3.1:11:87122527:87144229:-1 gene:ENSGGOG00000024492 transcript:ENSGGOT00000029527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSGILQVFQRELICPMCMNYFVDPVTTDCGHSFCRPCFYLNWQDIPFLVQCSECTKSTE
QINLQTDIHLKKMASLARKVSLWLFLSSEEQMCGTHRETKKMFCEVDRSLLCLLCSSSQE
HRYHRHRPIEWAAEEHREKLLQKMQSLWEKACENHRNLNVESTRTRCWKDYMNLRLEAIR
AEYEKMAAFHHEEEKHNLEMLKKKGKDIFHRLHLSKAKMAHRREILRGMYEELNEMCHKP
DVELLQCWESIAPLRDSTRPKVPPTLSTSHKTLWNGQGLLNRLLETYYTDIDSTFFCIYF
RPTMSGESVITYNVIWIFIQISRAVLNSGKYYWEVHVGDSWNWAFGVCNKYWKEKNQNEK
IDGEEGLFLLGCVKNDIQRSLFTTSPLMLQYIPRPTSRVGLFLDCEAKTVSFVDVNQSSL
IYTIPNCSFSPPLRPIF
Download sequence
Identical sequences ENSGGOP00000024901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]