SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024917 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024917
Domain Number 1 Region: 3-66
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000251
Family Nucleosome core histones 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024917   Gene: ENSGGOG00000028129   Transcript: ENSGGOT00000029506
Sequence length 93
Comment pep:novel chromosome:gorGor3.1:10:90693697:90694086:1 gene:ENSGGOG00000028129 transcript:ENSGGOT00000029506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMTGNKAGKDSGKNKTKAVSHSQRAGLQFPLPELAAKASKDFKVKRITLRHLQLAVCGDE
ELDSVIEATIADGGVIPHTHRSLMGKKGQQKAV
Download sequence
Identical sequences ENSGGOP00000024917 ENSGGOP00000024917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]