SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024994 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024994
Domain Number 1 Region: 152-468
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.45e-129
Family Transglutaminase core 0.00000000705
Further Details:      
 
Domain Number 2 Region: 6-151
Classification Level Classification E-value
Superfamily E set domains 2.38e-41
Family Transglutaminase N-terminal domain 0.0002
Further Details:      
 
Domain Number 3 Region: 624-722
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.44e-27
Family Transglutaminase, two C-terminal domains 0.0002
Further Details:      
 
Domain Number 4 Region: 511-622
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.4e-27
Family Transglutaminase, two C-terminal domains 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024994   Gene: ENSGGOG00000006555   Transcript: ENSGGOT00000028725
Sequence length 725
Comment pep:known_by_projection chromosome:gorGor3.1:15:21944276:21973341:-1 gene:ENSGGOG00000006555 transcript:ENSGGOT00000028725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNPGCPIAGLEVALTDLQSSRNNVRHHTEEITVDHLLVRRGQAFSLTLYFRNRGFQPGLD
NIIFVVETGPLPDLALGTRAVFSLARHHSPSPWIAWLETNGATSTEVSLCAPPTAAVGRY
LLKIHIDSFQGSVTAYQLGEFILLFNPWCPEDAVYLDSEPQRQEYVMNDYGFIYQGSKNW
IRPCPWNYGQFEDKIIDICLKLLDKSLHFQTDPATDCALRGSPVYVSRVVCAMINSNDDN
GVLNGNWSENYTDGANPAEWTGSVAILKQWNATGCQPVRYGQCWVFAAVMCTVMRCLGIP
TRVITNFDSGHDTDGNLIIDEYYDNTGRILGNKKKDTIWNFHVWNECWMARKDLPPGYGG
WQVLDATPQEMSNGVYCCGPASVRAIKEGEVDLNYDTPFVFSMVNADCMSWLVQGGKEQK
LHQDTSSVGNFISTKSIQSDERDDITENYKYEEGSLQERQVFLKALQKLKARSFHGSQRG
AELQPSRPTSLSQDSPRSLHTPSLQPSDVVQVSLKFKLLDPPNMGQDICFVLLALNMSSQ
FKDLKVNLSAQSLLHDGSPLSPFWQDTAFITLSPKEAKTYPCKISYSQYSQYLSTDKLIR
ISALGEEKSSPEKILVNKIITLSYPSITINVLGAAVVNQPLSIQVIFSNPLSEQVEDCVL
TVEGSGLFKKQQKVFLGVLKPQHRASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVY
VDFAL
Download sequence
Identical sequences ENSGGOP00000024994 ENSGGOP00000006416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]