SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025015 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025015
Domain Number 1 Region: 45-121
Classification Level Classification E-value
Superfamily HMG-box 3.53e-29
Family HMG-box 0.0000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025015   Gene: ENSGGOG00000027463   Transcript: ENSGGOT00000028574
Sequence length 233
Comment pep:known_by_projection chromosome:gorGor3.1:17:7791486:7793466:-1 gene:ENSGGOG00000027463 transcript:ENSGGOT00000028574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPGSSQDQAWSLEPPAATAAASSPSGPQEREGAGSPAAPGALPLEKVKRPMNAFMVWS
SAQRRQMAQQNPKMHNSEISKRLGAQWKLLDEDEKRPFVEEAKRLRARHLRDYPDYKYRP
RRKAKSSGAGPSRCGQGRGNLASGGPLWGPGYVTTQPSRGFGYRPPSYSTAYLPGSYGSS
HCKLEAPSPCSLPQSDPRLQGELLPTYTHYLPPGSPTPYNPPLSGAPMPLTHL
Download sequence
Identical sequences G3SA93
ENSGGOP00000025015 ENSGGOP00000025015 XP_004058551.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]