SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025020 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025020
Domain Number 1 Region: 45-788
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.5e-267
Family Motor proteins 0.00000000041
Further Details:      
 
Domain Number 2 Region: 1971-2087
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-21
Family Second domain of FERM 0.0036
Further Details:      
 
Domain Number 3 Region: 2088-2162
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000923
Family Third domain of FERM 0.026
Further Details:      
 
Domain Number 4 Region: 1871-1978
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000284
Family Ras-binding domain, RBD 0.032
Further Details:      
 
Domain Number 5 Region: 1344-1437
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000733
Family Second domain of FERM 0.0065
Further Details:      
 
Domain Number 6 Region: 1250-1352
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000101
Family Ubiquitin-related 0.042
Further Details:      
 
Domain Number 7 Region: 1586-1653
Classification Level Classification E-value
Superfamily SH3-domain 0.000000135
Family SH3-domain 0.0024
Further Details:      
 
Domain Number 8 Region: 795-859
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000425
Family Motor proteins 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025020   Gene: ENSGGOG00000004731   Transcript: ENSGGOT00000022239
Sequence length 2163
Comment pep:known_by_projection chromosome:gorGor3.1:2b:14543974:14620716:1 gene:ENSGGOG00000004731 transcript:ENSGGOT00000022239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLSALQGDHVWLEPPSTHKTGVAIGGIIKEAKPGKVSVEDGEGKEHWIRAEDFGVLSPMH
PNSVQGVDDMIRLGDLNEAGMVHNLLIRYQQHKIYTYTGSILVAVNPFQVLPLYTLEQVQ
LYYSRHMGELPPHVFAIANNCYFNMKRNKRDQCCIISGESGAGKTETTKLILQFLATISG
QHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIYFNPSGVIEGARIEQFLLEKS
RVCRQAPEERNYHIFYCMLMGMSAEDKQLLSLGTPSEYHYLTMGNCTSCEGLNDAKDYAH
IRSAMKILQFSDSESWDITKLLATILHLGNVGFMASVFENLDASDVMETPAFPTVMKLLE
VQHQELRDCLIKHTILIRGEFVTRPLNIAQAADRRDAFVKGIYGHLFLWIVKKINAAIFT
PPAQDPRNVRRAIGLLDIFGFENFENNSFEQLCINFANEHLQQFFVQHVFTMEQEEYRSE
NISWDYIHYTDNRPTLDLLALKPMSIISLLDEESRFPQGTDLTMLQKLNSIHANNKAFLQ
PKNIHDARFGIAHFAGEVYYQAEDTCRKRWETGSLPSPTLDSSSPDPQQAVQMDVWLSAD
SNKRPSTLGSQFKQSLDQLMKILTNCQPYFIRCIKPNEYKKPLLFDRELCLRQLRYSGMM
ETVHIRKSGFPIRYTFEEFSQRFGVLLPNAMRMQLRGKFRQMTLGITDVWLRTDKDWKVG
KTKIFLKDHQDTLLEVQRSQVLDRAALSIQKVLRGYRYRKEFLRQRRAAVTLQAWWRGYC
NRRNFKLILVGFERLQAIARSQLLARQYQAMRQRTVQLQALCRGYLVRQQVQAKRRAVVV
IQAHARGMAARRNFRQRKANGRDGRSPGRCSKAEPDKLRGQRNINTKAGLGPLSPAGPLG
NLPPRGMQAPLVIPAEGQKSQGALPAKKRRSIYDTVTDTEMVEKVFGFLPAMIGGQEGQA
SPRFEDLESKTQKLLEVDLDTVPMAEEPEEDVDGLAEYTFPKFAVTYFQKSASHTHIRRP
LRYPLLYHEDDTDCLAALVIWNVILRFMGDLPEPVLYARSSQQGSSVMRQIHDTLGREHG
AQVPQHSRSAQASGGQQRAEEGDTCQIQMHITLKRSSRITGQVASQLNIGEEALEPNGLG
ADRPMSNLEKVHFIVGYAILRPSLRDEIYCQICKQLSENFKTSSLARGWILLSLCLGCFP
PSERFMKYLLNFIGQGPATYGPFCAERLRRTYANGVRAEPPTWLELQAVKSKKHIPIQVI
LATGESLTVPVDSASTSREMCMHIAHKQGLSDHLGFSLQVAVYDKFWSLGSGRDHMMDAI
AQCEQMAQEKGESQRQSPWRIYFRKEFFTPWHDSREDPVSTELIYRQVLHGVWSGEYSFE
KEEELVELLARHCYVQLGASAESKAVQELLPSCIPHKLYRTKPPDRWASLVTAACAKAPY
TQKQATPLAVREQVVDAARLQWPLLFSRLFEVITLSGPRLPKTQLILAVNWKGLCFLDQR
EKTLLELSFPEVMGLATNRVARASLGCARCTVATTPHWPPLTEAQGGQRLLLSTMHEEYE
FVSPSSVAIAELVALFLEGLKERSIFAMALQDRKATGANDTTLLAFKKGDLLVLTKKQGL
LASENWTLGQNDRTGKTGLVPMACLYTIPTVTKPSAQLLSLLAMSPEKRKLAAQEGQFTE
PCPEEPXHVEPAWPSQARAPEKDMVSMAMLPLARARGHLWAYSSEPLRQPLLKRVHANVD
LWDIACQIFVATPILRYMGDYPSRQAWPTLELTDQIFTLALQHPALQDEVYCQILKQLTH
NSNRHSEERGWQLLWLCTGLFPPSKGLLPHAQKFIDTRRGKLLAPDCSRRIQKVLRTGPR
KQPPHQVEVEAAEQNVSRICHKIYFPNDTSEVLEVVANTRVRDVCDSIATRLQLASWEGC
SLFIKISDKVISQKEGDFFFDSLRQVSDWVKKNKPQKEGAPVMLPYQVYFMRKLWLNISP
GKDVNADTILHYHQELPKYLRGFHKCSREDAIHLAGLIYKAQFNNDRSQLASVPKILREL
VPENLTRLMSSEEWKKSILLAYDKHKDKTVEEAKVAFLKWICRWPTFGSAFFEVKQTSEP
SYPDVILIAINRHGVLLIHPKTKDLLTTYPFTKISSWSSGSTYFHMVLGSLGRGSRLLCE
TSL
Download sequence
Identical sequences ENSGGOP00000025020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]