SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025059 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025059
Domain Number 1 Region: 1100-1422
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.61e-63
Family YicI catalytic domain-like 0.00041
Further Details:      
 
Domain Number 2 Region: 332-604
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.27e-59
Family YicI catalytic domain-like 0.002
Further Details:      
 
Domain Number 3 Region: 88-331
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 9.1e-51
Family YicI N-terminal domain-like 0.0057
Further Details:      
 
Domain Number 4 Region: 849-1096
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.65e-45
Family YicI N-terminal domain-like 0.0084
Further Details:      
 
Domain Number 5 Region: 1425-1505
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.01e-16
Family Putative glucosidase YicI, domain 3 0.024
Further Details:      
 
Domain Number 6 Region: 607-687
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000000000101
Family Putative glucosidase YicI, domain 3 0.02
Further Details:      
 
Domain Number 7 Region: 821-873
Classification Level Classification E-value
Superfamily Trefoil 0.000000000523
Family Trefoil 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025059   Gene: ENSGGOG00000027385   Transcript: ENSGGOT00000033937
Sequence length 1645
Comment pep:known_by_projection chromosome:gorGor3.1:3:165780433:165875467:-1 gene:ENSGGOG00000027385 transcript:ENSGGOT00000033937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKKFSGLEISLIVLFVIVTIIAIALIVVLATKTPAVDEISDSTSTPATTRVTTNPSDS
GKCPNVLNDPVNVRINCIPEQFPTEGICAQRGCCWRPWNDSLIPWCFFVDNHGYNVQDMT
TTSIGVEAKLNRIPSPTLFGNDINSVLFTTQNQTPNRFRFKITDPNNRRYEVPHQYVKEF
TGPTVSDTLYDVKVAQNPFSIQVTRKSNGKTLFDTSIGPLVYSDQYLQISTRLPSDYIYG
IGEQVHKRFRHDLSWKTWPIFTRDQLPGDNNNNLYGHQTFFMCIEDTSGKSFGVFLMNSN
AMEIFIQPTPIVTYRVTGGILDFYILLGDTPEQVVQQYQQLVGLPAMPAYWNLGFQLSRW
NYKSLDVVKEVVRRNREAGIPFDTQVTDIDYMEDKKDFTYDQVAFNGLPQFVQDLHDHGQ
KYVIILDPAISIGQRANGTTYATYERGNTQHVWINESDGSTPIIGEAVQKVFPNKRSFIL
TRSTFAGSGRHAAHWLGDNTASWEQMEWSITGMLEFSLFGIPLVGADICGFVAETTEELC
RRWMQLGAFYPFSRNHNSDGYEHQDPAFFGQNSLLVKSSRQYLTIRYTLLPFLYTLFYKA
HVFGETVARPVLHEFYEDTNSWTEDTEFLWGPALLITPVLKQGADTVSAYIPDAIWYDYE
SGAKRPWRKQRVDMYLPADKIGLHLRGGYIIPIQEPDVTTTASRKNPLGLIVALGENNTA
KGDFFWDDGETKDTIQNGNYILYTFSVSNNTLDIVCTHSSYQEGTTLAFQTVKILGLTDS
VTEVRVAENNQPMSAHSNFTYDASNQVLLIADLKLNLGRNFSVQWNQIFSENERFNCYPD
ADLATEQKCTQRGCIWRTGSSLSKAPECYFPRQDNSYSVNSARYSSMGITADLQLNTANA
RIKLPSDPISTLRVEVKYHKNDMLQFKIYDPQKKRYEVPVPLNIPTTPISTYEDRLYDVE
IKENPFGIQIRRRSSGRVIWDSGLPGFAFNDQFIQISTRLPSEYIYGFGEVEHTAFKRDL
NWNTWGMFTRDQPPGYKLNSYGFHPYYMALEEEGNAHGVFLLNSNAMDVTFQPTPALTYR
TVGGILDFYMFLGPTPEVATKQYHEVIGHPVMPAYWALGFQLCRYGYANTSEVRELYDAM
VAANIPYDVQYTDIDYMERQLDFTIGEAFQDLPQFVDKIRGEGMRYIIILDPAISGNETK
TYPAFERGQQNDVFVKWPNTNDICWAKVWPDLPNITIDKTLTEDEAVNASRAHAAFPDFF
RTSTAEWWAREIVDFYNEKMKFDGLWIALQKTTGKRGIVISRSTYPTSGRWGGHWLGDNY
ARWDNMDKSIIGMMEFSLFGISYTGADICGFFNNSEYHLCTRWMQLGAFYPYSRNHNIAN
TRRQDPASWNETFAEMSRNILNIRYTLLPYFYTQMHEIHANGGTVIRPLLHEFFDEKPTW
DIFKQFLWGPAFMVTPVLEPYVQTVNAYVPNARWFDYHTGKDIGVREQFQTFNASYDTIN
LHVRGGHILPCQEPAQNTFYSRQKHMKLIVAADDNQMAQGSLFWDDGESIDTYERDLYLS
VQFNLNQTTLTSTILKRGYINKSETRLGSIQVWGKGTNPVNAVTLTYNGNKNSLPFNEDS
TNMILHIDLTTHNVTLEEPIEINWS
Download sequence
Identical sequences ENSGGOP00000025059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]