SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025112 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025112
Domain Number 1 Region: 483-714
Classification Level Classification E-value
Superfamily GFP-like 2.72e-91
Family Domain G2 of nidogen-1 0.00000000137
Further Details:      
 
Domain Number 2 Region: 1075-1311
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-46
Family YWTD domain 0.000000000824
Further Details:      
 
Domain Number 3 Region: 994-1051
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 6.41e-21
Family Thyroglobulin type-1 domain 0.00076
Further Details:      
 
Domain Number 4 Region: 849-894
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000994
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 758-804
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000449
Family EGF-type module 0.011
Further Details:      
 
Domain Number 6 Region: 922-962,1332-1376
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000033
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 7 Region: 812-860
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000265
Family EGF-type module 0.044
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000025112
Domain Number - Region: 725-752
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000567
Family EGF-like domain of nidogen-1 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025112   Gene: ENSGGOG00000000381   Transcript: ENSGGOT00000029307
Sequence length 1379
Comment pep:known_by_projection chromosome:gorGor3.1:1:216259778:216347216:-1 gene:ENSGGOG00000000381 transcript:ENSGGOT00000029307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALLLPLLLAGPVGCLSRQELFPFGPGQGDLELEDGDDLVSPALELSGALRFYDRSDIDSV
YVTTNGIIATSEPPAKESHPGLFPPTFGAVAPFLADLDTTDGLGKVYYREDLSPSITQRA
AECVHRGFPEISFQPSSAVVVTWESVAPYQGPSRDPDQKGKRNTFQAVLASSDSSSYAIF
LYPEDGLQFHTTFSKKENNQVPAVVAFSQGSVGFLWKSNGAYNIFANDRESIENLAKSSN
SGQQGVWVFEIGSPATTNGVVPADVILGTEDGAEYDDEDEDYDLETTRLGLEDVGTTPFS
YKALRSPLPAPGSYRKAPWTSHRENQVFPVGSGDFSPAAPSGFGIRIVDYFSSQVPSVSE
LVCELLSPAGPQKAGLDQSLWQVNAPSGRLEFVLIPELTQKWQNPTMLNIPPFRYKPHIL
TLYTHPGIDLWFKYLLDSCYLKKNVSSSNFCVIDQAGKCLYSQGHSGWLGSDLYILSLFS
CSGSPQRVNGKVKGRIFVGSSQIPIVFENTDLHSYVVMNHGRSYTAISTIPETVGYSLLP
LAPVGGIIGWMFAVEQDGFKNGFSITGGEFTRQAEVTFVGHPGNLVIKQRFSGIDEHGHL
TIDTELEGRVPQIPFGSSVHIEPYTELYHYSTSVITSSSTREYTVTEPERDGASPSRIYT
YQWRQTITFQECIHDDSRPALPSTQQLSVDSVFVLYNQEERILRYALSNSIGPVREGSPD
ALQNPCYIGTHGCDTNAACRPGPRTQFTCECSIGFRGDGRTCYDIDECSEQPSVCGSHTI
CNNHPGTFRCECVEGYQFSDEGTCVAVVDQRPINYCETGLHNCDIPQRARCIYTGGSSYT
CSCLPGFSGDGQACQDVDECQPSRCHPDAFCYNTPGSFTCQCKPGYQGDGFRCVPGGPVS
SLRTCELIEGGAVTKILYVSACQHVCVCVCTFFFLSLYCKNKTDSCFCLQGNGMQIQGQQ
LELGKAPPHADVIDPRPIQPQSSTHQKKAQSVRYRYGVGKPRSRLFVPECDAHGHYAPTQ
CHGSTGYCWCVDRDGREVEGTRTRPGMTPPCLSTVAPPIHQGPAVPTAVIPLPPGTHLLF
AQTGKIERLPLEGNTMRKTEAKAFLHVPAKVIIGLAFDCVDKMVYWTDITEPSIGRASLH
GGEPTTIIRQDLGSPEGIAVDHLGRNIFWTDSNLDRIEVAKLDGTQRRVLFETDLVNPRG
IVTDSVTGNLYWTDWNRDNPKIETSYMDGTNRRILVQDDLGLPNGLTFDAFSSQLCWVDA
GTNRAECLNPSQPPRRKVLEGLQYPFAVTSYGKNLYFTDWKMNSVVALDLAISKETDAFQ
PHKQTRLYGITTALSQCPQGHNYCSVNNGGCTHLCLATPGSRTCRCPDNTLGVDCIERK
Download sequence
Identical sequences ENSGGOP00000025112 ENSGGOP00000000375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]