SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025133 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025133
Domain Number 1 Region: 70-170
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.98e-29
Family 2Fe-2S ferredoxin-related 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025133   Gene: ENSGGOG00000006009   Transcript: ENSGGOT00000031979
Sequence length 184
Comment pep:known_by_projection chromosome:gorGor3.1:19:10507391:10513571:-1 gene:ENSGGOG00000006009 transcript:ENSGGOT00000031979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVMAASMARGGVSARVLLQAAKGTWWKRPGGTSGSGEGVAPGTTRKFPGSRPAGEEDAG
GPERPGDVVNVVFVDRSGQRIPVSGRVGDNVLHLAQRHGVDLEGACEASLACSTCHVYVS
EDHLDLLPPPEEREDDMLDMAPLLQENSRLGCQIVLTPELEGAEFTLPKITRNFYVDGHV
PKPH
Download sequence
Identical sequences ENSGGOP00000005878 ENSGGOP00000025133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]