SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025136 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025136
Domain Number 1 Region: 49-121
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.05e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025136   Gene: ENSGGOG00000000451   Transcript: ENSGGOT00000030646
Sequence length 340
Comment pep:known_by_projection chromosome:gorGor3.1:16:4484826:4502359:-1 gene:ENSGGOG00000000451 transcript:ENSGGOT00000030646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRR
MQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQEL
SGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLE
AHMYPEKLKVIDLRTQYKGGEAVIHWPALHEGEVDGPREALRERLLPPPAPTHHPTVIVP
APPPPPSHHINVVTMGPSSVINSVSTSRQNLDTIVQAIQHIEGTQEKQELEEEQRRAVIV
KPVRSCPEAPTSDTASDSEASDSDAMDQSREEPSGDGELP
Download sequence
Identical sequences ENSGGOP00000025136 ENSGGOP00000025136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]