SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025137 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000025137
Domain Number - Region: 16-55
Classification Level Classification E-value
Superfamily Prefoldin 0.017
Family Prefoldin 0.029
Further Details:      
 
Domain Number - Region: 116-163
Classification Level Classification E-value
Superfamily t-snare proteins 0.0863
Family t-snare proteins 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025137   Gene: ENSGGOG00000022295   Transcript: ENSGGOT00000029353
Sequence length 209
Comment pep:novel chromosome:gorGor3.1:X:47510022:47510681:-1 gene:ENSGGOG00000022295 transcript:ENSGGOT00000029353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INQFFGKVKPKAPLPSLTDCIDTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKSM
VKQKASQKWMYEQQQSFNMEQANYTIQSLKDTKTMVDAMKLGVKEMKKAYKQVKIDQIED
LRDQLEDMMEDANEIQEAMSRSYGTPELDEDDLEAKLDALGDELLADEDSSYLDETASVP
AIPEGVPTDMKNKDGVLVDEFGLPQIPTS
Download sequence
Identical sequences ENSGGOP00000025137 ENSGGOP00000025137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]