SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025171 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025171
Domain Number 1 Region: 246-311
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000136
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000638
Further Details:      
 
Domain Number 2 Region: 341-411
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000105
Family Eukaryotic type KH-domain (KH-domain type I) 0.00029
Further Details:      
 
Domain Number 3 Region: 151-231
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000453
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000843
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000025171
Domain Number - Region: 75-177
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000886
Family Eukaryotic type KH-domain (KH-domain type I) 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025171   Gene: ENSGGOG00000023069   Transcript: ENSGGOT00000032672
Sequence length 519
Comment pep:novel chromosome:gorGor3.1:9:22101349:22103717:1 gene:ENSGGOG00000023069 transcript:ENSGGOT00000032672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GHTGGHQEQPVGVQAEGLYSPLHIRAKIAAKIVGDAATTVNNSTPDFGLGGHKRQLEDGG
DSISSQLGPIHRPPRTSMTEEYRVPDGVVGLNFGRGGDSACKVQITPDSSGLPKHSVSLT
RAPESLQKAEMMLDDIVSRGHGGPPGQFHDNANGGQNGTAQDMIPAGKAGLVIAKGGEQL
QEYAGVKMILIQDGSQNTNVDNPLRIPGDPYKVQQACQMVMDILRERDQGGFGDWNDYGS
RIGGGIDVPVPRHSVGVVIGRRGEMIKKIQNDAGVRIQFKQDDGTGPEKIAHIMGSPDRC
EHAARIINDLRVVPQALQGVQACPRGGRRRGQGNWGPPGGEMTFSIPTHKRRLVIGGGGQ
NVKVINQQTGAFVEISRQLPSSGDPNFKLFIIQGSPQQIQHAEQLIEGAVQPGATWAPPR
AGGLPPHQGWGNTYPQWQPPAPHDPSKAAAATADANATWAAYYSHFYQQSPPGRRPRAGC
QPDYNAVWGEYYRQQAAYYGQIPGPGSHASGTAAGSMNR
Download sequence
Identical sequences ENSGGOP00000025171 ENSGGOP00000025171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]