SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025183 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025183
Domain Number 1 Region: 103-406,471-682
Classification Level Classification E-value
Superfamily SNF-like 6.67e-115
Family SNF-like 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025183   Gene: ENSGGOG00000016349   Transcript: ENSGGOT00000030422
Sequence length 736
Comment pep:known_by_projection chromosome:gorGor3.1:19:46622919:46644731:-1 gene:ENSGGOG00000016349 transcript:ENSGGOT00000030422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTEAQPSTSSLANTSWTGTVISDSVPGSQKWEDKGSLTWSATSWTSEAQVSAARVAEAQ
ARTSQPKQISVLEALTASALNQKPMYEKVQMTEKKESEVLLARPFWSSKTEYILAQVGFS
MKPSCLWRFAYLWLNSGGCSFAAIYIFMLFLVGVPLLFLEMAAGQSMRQGGMGVWKIIAP
WIGGVGYSSFMVCFILGLYFNVVNSWIIFYMSQSFQFPVPWEKCPLTMNSSGFDPECERT
TPSIYFWYQQALKASDRIEDGGSPVYSLVLPFFLCWCLVGAFMINGLKSTGKVIYVLVLL
PCFIIVGFFIRTLLLEGAKFGLQQLVVAKISDVYNMSVWSLAGGQVLSNTGIGLGSVASV
ASYMPQSNNCLSDAFLVSVINLLTLLIFTSFNFCVLGFWATVITHRCCERNVEILLKLIN
LGKLPPDAKPPVNLLYNPTSIYNAWLSGLPQHIKSMVLREVTECNIETQFLKASEGPKFA
FLSFVEAMSFLPPSVFWSFIFFLMLLAMGLSSAIGIMQGIITPLQDTFSFFRKHTKLLIV
GVFLLMFVCGLFFTRPSGSYFIRLLSDYWIVFPIIVIVVFETMAVSWAYGARRFLADLTI
LLGHPISPIFGWLWPHLCPVVLLIIFVTTMVHLCMKPITYMSWDSSTSKEVLRPYPPWAL
LLMITLFAIVILPIPAYFVYCRIHRIPFRPKSGDGPMTASTSLPLNHQLTPSKEVQKEEI
LQVDETKYPSTCNVTS
Download sequence
Identical sequences G3SAR0
ENSGGOP00000025183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]