SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025186 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025186
Domain Number 1 Region: 206-396
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.89e-54
Family Reprolysin-like 0.00025
Further Details:      
 
Domain Number 2 Region: 415-490
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 5.36e-22
Family Blood coagulation inhibitor (disintegrin) 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025186   Gene: ENSGGOG00000023328   Transcript: ENSGGOT00000024571
Sequence length 722
Comment pep:novel chromosome:gorGor3.1:14:51633207:51635425:1 gene:ENSGGOG00000023328 transcript:ENSGGOT00000024571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVDGTRVYIRVTLLLLWLGVFLSISGYCQAGPSQHFTSPEVVIPLKVISRGRSAKAPGW
LSYSLRFGGQKHVVHMRVKKLLVSRHLPVFTYTDERALLEDQLFIPDDCYYHGYVEAAPE
SLVVFSACFGGFRGVLKISGLTYEIEPIRHSATFEHLVYKINSNETQFPAMRCGLTEKEV
ARQQLEFEEAENSALEPKSAGDWWTHAWFLELVVVVNHDFFIYSQSNISKVQEDVFVVVN
IVDSMYKQLGTYIILIGIEIWNQGNVFPMTSIEQVLNDFSQWKQISLSQLQHDAAHMFIK
NSLISILGLAYVAGICRPPIDCGVDNFQGDTWSLFANTVAHELGHTLGMQHDEEFCFCGE
RGCIMNTFRVPAEKFTNCSYADFMKTTLNQGSCLHDPPRLGEIFMLKRCGNGVVEREEQC
DCGSVQQCEQDACCLLNCTLRPGAACAFGLCCKDCKFMPSGELCRQEVNECDLPEWCNGT
SHQCPEDRYVQDGIPCSDSAYCYQKRCNNHDQHCREIFSKDAKSASQNCYKEINSQGNRF
GHCGINGTTYLKCHISDVFCGRVQCENVRDIPLLQDHFTLQHTHINGVTCWGIDYHLRMN
ISDIGEVKDGTVCGPGKICIHKKCVSLSVLSHVCLPETCNMKGICNNKHHCHCGYGWSPP
YCQHRGYGGSIDSGPASAKRGVFLPLIVIPSLSVLIFLFTVGLLMYLRPCSGPKETKAHS
SG
Download sequence
Identical sequences ENSGGOP00000025186 ENSGGOP00000025186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]