SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025188 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025188
Domain Number 1 Region: 228-275
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.57e-16
Family TRASH domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025188   Gene: ENSGGOG00000022435   Transcript: ENSGGOT00000031913
Sequence length 667
Comment pep:known_by_projection chromosome:gorGor3.1:13:1442277:1469848:-1 gene:ENSGGOG00000022435 transcript:ENSGGOT00000031913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKCSVGGLEFTEQTPALLGNIAMATSLMDIGDSFGHPACPLVSRSRNSPVEDDDDDDVV
FIESIQPPSVSAPAIADQRNFIFASSKNEKPQGNYSVIPPSRDLASQKGNISETIVIDDE
EDIETNGGAEKKSSCFIEWGLPGTKNKTNDLDFSTSSLSRSKTKTGVRPFNPGRMNVAGD
LFQNGEFATHHSPDSWISQSASFPSNQKQPGVDSLSPVALLRKQNFQPTAQQQLTKPAKI
TCANCKKPLQKGQTAYQRKGSAHLFCSTTCLSSFSHKRTQNTRSIICKKDASTKKANVIL
PVESSKSFQEFYSTSCLSPCENNWNLKKGVFNKSRCTICSKLAEIRHEVSVNNVTHKLCS
NHCFNKYRLANGLIMNCCEHCGEYMPSKSTGNNILVIGGQQKRFCCQSCINEYKQMMETK
SKKLTASENRKRNAFREENEKQLYGSSNTLMKKIEGIPEKKEKTSQLQLSVECGTDTLLI
QESVNLPPPSTSTIADTFQEQLEEKNFEDSIVPVVLSADPGTWPRILNIKQRDTLVENVP
PQVRNFNFPKDNTGRKFSETYYTRILPNGEKTTRSWLLYSTSKDSVFCLYCKLFGEGKNQ
LKNENGCKDWQHLSHILSKHEESEMHINNSVKYSKLKSDLKKNKAIDAAERRLYENEKND
GVLLLYT
Download sequence
Identical sequences G3SAR5
ENSGGOP00000023119 XP_018895498.1.27298 XP_018895499.1.27298 XP_018895500.1.27298 ENSGGOP00000025188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]