SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025208 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025208
Domain Number 1 Region: 103-481
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.28e-68
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.000000000186
Further Details:      
 
Domain Number 2 Region: 5-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.73e-19
Family Ubiquitin-related 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025208   Gene: ENSGGOG00000003003   Transcript: ENSGGOT00000033383
Sequence length 494
Comment pep:known_by_projection chromosome:gorGor3.1:18:116716:160758:1 gene:ENSGGOG00000003003 transcript:ENSGGOT00000033383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VILFAVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKSDKSGH
IKVKKQGMTLLMMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNAT
VQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFL
HMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASVATPSKK
KSLIDQFFGVEFETTLQSMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLVRTI
SQKSNKLQLALHFIDKSIIDMVAYDFSLEIVVFNYSSCDSTSKALIIRIRKPLYPAFKEL
CAVFLDKLFFSCKSLLKNIEFKFYFQNHDSDKKSSPQKEVKYEPFSFADDIGSNNCGYYD
LQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLL
YGPRRVEIMEEESE
Download sequence
Identical sequences ENSGGOP00000025208 ENSGGOP00000025208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]