SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025284 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025284
Domain Number 1 Region: 113-276
Classification Level Classification E-value
Superfamily Caspase-like 2.88e-38
Family Caspase catalytic domain 0.00000831
Further Details:      
 
Domain Number 2 Region: 4-85
Classification Level Classification E-value
Superfamily DEATH domain 2.18e-16
Family Caspase recruitment domain, CARD 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025284   Gene: ENSGGOG00000023145   Transcript: ENSGGOT00000033741
Sequence length 276
Comment pep:known_by_projection chromosome:gorGor3.1:11:102522658:102546401:-1 gene:ENSGGOG00000023145 transcript:ENSGGOT00000033741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKGNHRKKPLKMLESLGKDFLTGVLDNLVEQNVLNWKEEEKKKYYDAKTEDKVRVMADS
IQEKQRMAGQMLLQTFFNIDQISPNKKAHPNMEAGPPESGESTDALKLCPHEEFLRLCKE
RAEEIYPIKERNNRTRLALIICNTEFDHLPPRNGADFDITGMKELLEGLDYSVDVEENLT
ARIIVQACRGANRGELWVRDSPATLEVASSQSSENLEEDAVYKTHVEKDFIAFCSSTPHN
VSWRDSTMGSIFITQLITCFQKYSWCCHLEEVFRKV
Download sequence
Identical sequences ENSGGOP00000025284 ENSGGOP00000025284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]