SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025310 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025310
Domain Number 1 Region: 449-554
Classification Level Classification E-value
Superfamily Homeodomain-like 5.73e-35
Family SWIRM domain 0.0000824
Further Details:      
 
Domain Number 2 Region: 171-224,264-309
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000000131
Family BRCT domain 0.055
Further Details:      
 
Domain Number 3 Region: 623-676
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000209
Family Homeodomain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025310   Gene: ENSGGOG00000016758   Transcript: ENSGGOT00000022807
Sequence length 1111
Comment pep:known_by_projection chromosome:gorGor3.1:3:48823637:49007276:-1 gene:ENSGGOG00000016758 transcript:ENSGGOT00000022807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAEEAAEAAGRASPTRARTSAAHACALACVRYRRKDGGPATKFWESPETVSQLDSVRVWL
GKHYKKKSYKHGIYPVNYLLKGQSVLFMEFKRNSFGEKKVVSVQFISFGAKCFMDFKAGG
TLCHILGAAYKYKNEQGWRRFDLQNPSRMDRNVEMFMNIEKTLVQNNCLTRPNIYLIPDI
DLKLANKLKDIIKRHQGTFTDEKSKASHHIYPCSSSQDDEEWLRPVMRKEKQVLVHWGFY
PDSYDTWVHSNDVDAEIEDPPIPEKPWKVHVKWILDTDIFNEWMNEEDYEVDENRKPVSF
RQRISTKNEEPVRSPERRDRKASANARKRKHSPSPPPPTPTESRKKSGKKGQDSASGCRQ
KNKKKNPKCSLNIDKPPPFPPPPPRYYVFSSSMNLKKDSENTPVKGGTVADLDEQDEETV
TAGGKEDEDPAKGDQSRSVDPGEDNVTEQTNHIIIPSYASWFDYNCIHVIERRALPEFFN
GKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVN
YQVDPESRPMAMGPPPTPHFNVLADTPSGLVPLHLRSPQVPAAQQMLNFPEKNKEKPVDL
QNFGLRTDIYSRKTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDE
CILHFLRLPIEDPYLENSDASLGPLAYQPVPFSQSGNPVMSTVAFLASVVDPRVASAAAK
AALEPEEFSRVREEVPLELVEAHVKKVQEAARASGKVDPTYGLESSCIAGTGPDEPEKLE
GAEEEKMEADPDGQQPEKAENKVENETDEGDKAQDGENEKNSEKEQDSEVSEDTKSEEKE
TEENKELTDTCKERESDTGKKKVEHEISEGNVATAAAAALASAATKAKHLAAVEERKIKS
LVALLVETQMKKLEIKLRHFEELETIMDREKEALEQQRQQLLTERQNFHMEQLKYAELRA
RQQMEQQQHGQNPQQAHQHSGGPGLAPLGAAGHPGMMPHQQPPPYPLMHHQMPPPHPPQP
GQIPGPGSMMPGQHMPGRMIPTVAANIHPSGSGPTPPGMPPMPVNILGPRVPLTAPNGMY
PPPPQQQPPPPPLADGVPPPPAPGPPASAAP
Download sequence
Identical sequences ENSGGOP00000025310 ENSGGOP00000016357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]