SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025315 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025315
Domain Number 1 Region: 29-148,340-648
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.35e-66
Family Integrin alpha N-terminal domain 0.0000494
Further Details:      
 
Domain Number 2 Region: 168-363
Classification Level Classification E-value
Superfamily vWA-like 3.67e-52
Family Integrin A (or I) domain 0.00000000672
Further Details:      
 
Domain Number 3 Region: 933-1134
Classification Level Classification E-value
Superfamily Integrin domains 8.89e-41
Family Integrin domains 0.0023
Further Details:      
 
Domain Number 4 Region: 791-928
Classification Level Classification E-value
Superfamily Integrin domains 6.8e-25
Family Integrin domains 0.0036
Further Details:      
 
Domain Number 5 Region: 652-790
Classification Level Classification E-value
Superfamily Integrin domains 4.34e-17
Family Integrin domains 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025315   Gene: ENSGGOG00000001285   Transcript: ENSGGOT00000027709
Sequence length 1180
Comment pep:known_by_projection chromosome:gorGor3.1:17:44153655:44221943:-1 gene:ENSGGOG00000001285 transcript:ENSGGOT00000027709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MICPGLINGGKILRDNLVVLGILNCCLAYNVGLPEAKIFSGPSSEQFGYAVQQFINPKGN
WLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLTLTR
NMGTGGFLTCGPLWAQQCGNQYYTTGVCSDISPDFQLSASFSPAAQPCPSLIDVVVVCDE
SNSIYPWDAVKNFLEKFVQGLDIGPTKTQVGLIQYANNPRVVFNLNTYKTKEEMIVATSQ
TSQYGGDLTNTFGAIQYARKYAYSAASGGRRSATKVMVVVTDGESHDGSMLKAVIDQCNH
DNILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLGEQI
FSIEGTVQGGDNFQMEMSQVGFSADYSSQNDILMLGAVGAFGWSGTIVQKTSHGHLIFPK
QAFDQILQDRNHSSYLGYSVAAISTGESTHFVAGAPRANYTGQIVLYSVNENGNITVIQA
HRGDQIGSYFGSVLCSVDVDKDTITDVLLVGAPMYMNDLKKEEGRVYLFTIKKGILGQHQ
FLEGPDGIENTRFGSAIAALSDINMDGFNDVIVGSPLENQNSGAIYIYNGHQGTIRTKYS
QKILGSDGAFRSHLQYFGRSLDGYGDLNGDSITDVSIGAFGQVVQLWSQSIADVAIEASF
TPEKITLVNKNAQIILKLCFSAKFRPTKQNNQVAIVYNITLDADGFSSRVTSRGLFKENN
ERCLQKNMVVNQAQSCPEHIIYIQEPSDVVNSLDLRVDISLENPGTSPALEAYSETAKVF
SIPFHKDCGEDGLCISDLVLDVQQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTGI
VVDFSENLFFASFSLPVDGTEVTCQVAASQKSVACDVGYPALKREQQVTFTINFDFNLQN
LQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINFYEISSDGNVPSIV
HSFEDVGPKFIFSLKVTTGSVPVSMATVIIHIPQYTKEKNPLMYLTGVQTDQAGDISCNA
DINPLKIGQTSSSVSFKRENFRHTKELNCRTASCSNVTCWLKDIHMKGEYFVNVTTRIWN
RTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPTGVIIGSIIA
GILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELSS
Download sequence
Identical sequences ENSGGOP00000025315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]