SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025319 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025319
Domain Number 1 Region: 211-355
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-25
Family Voltage-gated potassium channels 0.0045
Further Details:      
 
Domain Number 2 Region: 57-88,138-192
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.09e-22
Family Voltage-gated potassium channels 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025319   Gene: ENSGGOG00000022229   Transcript: ENSGGOT00000033557
Sequence length 427
Comment pep:known_by_projection chromosome:gorGor3.1:1:195236176:195392748:1 gene:ENSGGOG00000022229 transcript:ENSGGOT00000033557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWK
TVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQ
IVAAINAGIIPLGNTSNQISHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALL
GIPLFGFLLVYINQEHGSVFEKVMEVTEKNFMKKWNVSQTKIRIISTIIFILFGCVLFVA
LPAIIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAY
FAAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRAT
SIKRKLSAELAGNHNQELTPCRRTLSVNHLTSERDVLPPLLKTESIYLNGLTPHCAGEEI
AVIENIK
Download sequence
Identical sequences ENSGGOP00000025319 ENSGGOP00000025319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]