SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025322 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025322
Domain Number 1 Region: 70-431
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.25e-65
Family Ankyrin repeat 0.0000196
Further Details:      
 
Domain Number 2 Region: 546-601
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000144
Family SOCS box-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025322   Gene: ENSGGOG00000008574   Transcript: ENSGGOT00000022593
Sequence length 610
Comment pep:known_by_projection chromosome:gorGor3.1:7:121662541:121686337:1 gene:ENSGGOG00000008574 transcript:ENSGGOT00000022593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYTLSKKTDGPKLASIRSSGKRMDTNDDPDEDHLTSYDIQLSIQESIEASKTALCPERFV
PLSAQNRKLVEAIKQGHILELQEYVKYKYAMDEADEKGWFPLHEAVVQPIQQILEIVLDA
SYKTLWEFKTSDGETPLTLAVKAGLVENVRTLLEKGVWPNTKNDKGETPLLIAVKKGSYD
MVSTLIKHNTSLDQPCVKRWSAMHEAAKQGRKDTVALLLKHGGNVHLRDGFGVTPLGVAA
EYGHCDVLEHLIHKGGDVLALADDGASVLFEAAGGGNPDCISLLLEYGGSGNVPNRAGHL
PIHRAAYEGHYLALKYLIPVTSKNAIRKSGLTPIHSAADGQNAQCLELLIENGFDVNTLL
ADHISQSYDDERKTALYFAVSNNDVHCTEVLLAAGADPNLDPLNCLLVAVRANNYEIVRL
LLSHGANVNCYFMHVNDTRFPSVIQYALNDEVMLRLLLNNGYQVEMCFDCMHGDIFGNSF
VWSEIQEEVLPGWTSCVIKDNPFCEFITVPWMKHLVGRVTRVLIDYMDYVPLCAKLKSAL
EVQREWPEIRQILENPCSLKHLCRLKIRRLMGLQKLCQPASVEKLPLPPAIQRYILFKEY
DLYGQELKLT
Download sequence
Identical sequences ENSGGOP00000025322 ENSGGOP00000025322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]