SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025379 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025379
Domain Number 1 Region: 2-259
Classification Level Classification E-value
Superfamily L domain-like 9.52e-51
Family Internalin LRR domain 0.045
Further Details:      
 
Domain Number 2 Region: 428-727
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 6.41e-29
Family Rhodopsin-like 0.012
Further Details:      
 
Domain Number 3 Region: 208-359
Classification Level Classification E-value
Superfamily L domain-like 3.3e-25
Family Ngr ectodomain-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025379   Gene: ENSGGOG00000005825   Transcript: ENSGGOT00000023466
Sequence length 850
Comment pep:known_by_projection chromosome:gorGor3.1:1:182160616:182286334:1 gene:ENSGGOG00000005825 transcript:ENSGGOT00000023466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQNNQLGGIPAEALWELPSLQSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPV
RALNNLPALQAMTLALNRISHIPDYAFQNLTSLVVLHLHNNRIQHLGTHSFEGLHNLETL
DLNYNELQEFPVAIRTLGRLQELGFHNNNIKAIPEKAFMGNPLLQTIHFYDNPIQFVGRS
AFQYLPKLHTLSLNGATDIQEFPDLKGTTSLEILTLTRAGIRLLPSGMCQQLPRLRVLEL
SHNQIEELPSLHRCQKLEEIPSGLQHNRIWEIGADTFSQLSSLQALDLSWNAIRSIHPEA
FSTLRSLVKLDLTDNQLTTLPLAGLGGLMHLKLKGNLALSQAFSKDSFPKLRILEVPYAY
QCCPYGMCASFFKASGQWEAEDLHLDDEESSKRPLGLLARQAENHYDLDLDELQLEMEDS
KPHPSVQCSPTPGPFKPCEYLFESWGIRLAVWAIVLLSVLCNGLVLLTVFAGGPVPLPPV
KFVVGAIAGANILTGISCGLLASVDALTFGQFSEYGARWEMGLGCRATGFLAVLGSEASV
LLLTLAAVQCSVSISCVRAYGKSPSPGSIRAGVLGCLALAGLAAALPLASVGEYGASPLC
LPYAPPEGQPAALGFAVALVMMNSFCFLVVAGAYIKLYCDLPRGDFEAMWDCAMVRHVAW
LIFADGLLYCPVAFLSFASMLGLFPVMPEAVKSVLLVVLPLPACLNPLLYLLFNPHFRDD
LRRLRPRAGDSGPLAYAAAGELEKSSCDSTQALVAFSDVDLILEASEAGRPPGLETYGFP
SVTLISCQQPGAPRLEGSHCVEPEGNHFGNPQPSMDGELLLRAEGSTPAGGGSSGGGGFR
PSGLAFASHV
Download sequence
Identical sequences ENSGGOP00000025379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]