SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025386 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025386
Domain Number 1 Region: 234-311
Classification Level Classification E-value
Superfamily HMG-box 1.19e-16
Family HMG-box 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025386   Gene: ENSGGOG00000008921   Transcript: ENSGGOT00000031962
Sequence length 1503
Comment pep:known_by_projection chromosome:gorGor3.1:5:133850377:133904295:1 gene:ENSGGOG00000008921 transcript:ENSGGOT00000031962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRSAQPRPCYLNAPQQCPRAERPGRPTAGSHSFLLRPGPLAGSSPFALLDPLQAFEQFVW
VRPQARAGLLRLRQGSHAVTRRRPLPVRREGRRDGSPWRSVVCRCCRCSRQTGASVTTVS
LLSSSSSPGLDPRGPRQASKREGLSRLRAVCFSPRDARASPRLHFLVAAVTTGAASRRQR
GARVRQPSPSSSRRAKRLRECERRSLHAPPAMDASYDGTEVTVVMEEIEEAYCYTSPGPP
KKKKKYKIHGEKAKKPRSAYLLYYYDIYLKVQQELPHLPQSEINKKISESWRLLSVAERS
YYLEKAKLEKEGLDPNSKLSALTAVVPDIPGFRKILPRSDYIIIPKSSLQEDRSCPQLEL
CVAQNQMSPKEPPLVSNTAPETVPSHAGMAEQCLAVEALAEEVGALTQSGAVQEIATSEI
LSQDVLLEDASLEVGESHQPYQTSLVIEETLVNGSPDLPTGSLAVPHHQVGESVSVVTVM
RDSSESSSSAPATQFIMLPLPAYSVVENPTSIKLTTTYTRRGHGTCTSPGCSFTYVTRHK
PPKCPTCGNFLGGKWIPKEKPAKVKVELASGVSSKGSVVKRNQQPVTTEQNSSKENASKL
TLENSEAVSQLLNVAPPRELGEESEWEEVIISDAHVLVKEAPGNCGTAVTKTPVVKSGVQ
PEVTLGTTDNDSPGADVPTPSEGTSTSSPLPAPKKPTGVDLLTPGSRPPELKGRARGKPS
LLAAARPMRAILPAPVNVGRGSSMGLPRARQAFSLSDKTPSVRTCGLKPSTLKQLGQPIQ
QPSGPGEVKLPSGPSNRTSQVKVVEVKPDMFPPYKYSCTVTLDLGLATSRGRGKCKNPSC
SYVYTNRHKPRICPSCGVNLAKDRTEKTTKAIEVSSPLPDVLNATEPLSTAQREIQRQST
LQLLRKVLQIPENESELAEVFALIHELNSSRLILSNVSEETVTIEQTSWSNYYESPSTQC
LLCSSPLFKGGQNSLAGPQECWLLTASRLQTVTAQVKMCLNPHCLALHSFIDIYTGLFNV
GNKLLVSLDLLFAIRNQIKLGEDPRVSINVVLKSVQEQTEKTLTSEELSQLQELLCNGYW
AFECLTVRDYNDMICGICGVAPKVEMAQRSEENVLALKSVEFTWPEFLGSNEVNVEDFWA
TMETEVIEQVAFPASIPITKFDASVIAPFFPPLMRGAVVVNTEKDKNLDVQPVPGSGSAL
VRLLQEGTCKLDEIGSYSEEKLQHLLRQCGIPFGAEDSKDQLCFSLLALYESVQNGARAI
RPPRHFTGGKIYKVCPHQVVCGSKYLVRGESARDHVDLLASSRHWPPVYVVDMATSVALC
ADLCYPELTNQMWGRNQGCFSSPTEPPVCVSCPELLDQHYTVDMTETEHSIQHPVTKTAM
RRIVHAGIQPNPGDPSAGHHSLALCPELAPYATILASIVDSKPNSVRQRPIAFDNATHYY
LYNRLMDFLTSREIVNRQIHDIVQSCQPGEVVIRDTLYRLGVAQIKTETEEEGEEEEVAT
VAE
Download sequence
Identical sequences ENSGGOP00000025386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]