SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025391 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000025391
Domain Number - Region: 210-238
Classification Level Classification E-value
Superfamily Serum albumin-like 0.0958
Family Serum albumin-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025391   Gene: ENSGGOG00000011477   Transcript: ENSGGOT00000031802
Sequence length 292
Comment pep:known_by_projection chromosome:gorGor3.1:1:26740856:26753904:1 gene:ENSGGOG00000011477 transcript:ENSGGOT00000031802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGMEATVTIPIWQNKPHGAARSVVRRIGTNLPLKPCARASFETLPNISDLCLRDVPPVP
TLADIAWIAADEEETYARVRSDTRPLRHTWKPSPLIVMQRNASVPNLRGSEERLLALKKP
ALPALSRTTELQDELSHLRSQIAKIVAADAASASLTPDFLSPGSSNVSSPLPCFGSSFHS
TTSFVISDITEETEVEVPELPSVPLLCSASPECCKLEHKAACSSSEEDDCVSLSKASSFA
DMMGILKDFHRMKQSQDLNRSLLKEEDPAVLISEVLRRKFALKEEDISRKGN
Download sequence
Identical sequences G3SBB5
XP_004025246.1.27298 XP_004025248.1.27298 XP_004025249.1.27298 ENSGGOP00000025391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]