SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025433 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025433
Domain Number 1 Region: 284-315
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000903
Family CCCH zinc finger 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000025433
Domain Number - Region: 750-805
Classification Level Classification E-value
Superfamily RING/U-box 0.00083
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Domain Number - Region: 651-717
Classification Level Classification E-value
Superfamily Tropomyosin 0.0307
Family Tropomyosin 0.012
Further Details:      
 
Domain Number - Region: 83-105
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0451
Family CCCH zinc finger 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025433   Gene: ENSGGOG00000014915   Transcript: ENSGGOT00000023388
Sequence length 810
Comment pep:known_by_projection chromosome:gorGor3.1:16:1449443:1504289:-1 gene:ENSGGOG00000014915 transcript:ENSGGOT00000023388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDQRPGPGAAAAALSGPFPQTEKPTHYRYLKEFRTEQCPLFSQHKCAQHRPFTCFHWHFL
NQRRRRPLRRRDGTFNYSPDVYCSKYNEATGVCPDGDECPYLHRTTGDTERKYHLRYYKT
GTCIHETDARGHCVKNGLHCAFAHGPLDLRPPVCDVRELQAQEALQNGQLGGGEGVPDLQ
PGVLASQAMIEKILSEDPRWQDANFVLGSYKTEQCPKPPRLCRQGYACPHYHNSRDRRRN
PRRFQYRSTPCPSVKHGDEWGEPSRCDGGDGCQYCHSRTEQQFHPEIYKSTKCNDMRQTG
YCPRGPFCAFAHVENPFLSTQVQGTDSLSDPGRGRPALQTPASSTASWWARDPSRQQSLG
SPFHGRWPLGLGDALELGSESVTGGSVHLLCRGLRSKSGIQKEARAGSRTLRSQKPGARK
CTLKFLHYGQFYLSRQTSKITPPKNHLAVFAAVHPPASSVSSSLASSAGSGSSSPTALPA
PPARALPLGPASSTVEAVLAKRLGPNDLNHKSDTNALAKPHCSQEPRGPGAPESGRKLLQ
PPRSSGLPQVARGLSDPRSSGHPSPPTQLRGKFFKQSNVHTWTDANTHLGRGHSGAGPSS
TVSHSGLNGVPGSIWDFVSGSFSPSPSPILSAGPPSSSSASPNGAELARVRRQLDEAKRK
IRQWEESWQQVKQVCDAWQREAQEAKERARVADSDRQLALQKKEEVEAQVKQLQEELEGL
GVASTLPGLRGCGDIGTIPLPKLHSLQSQLRLDLEAVDGVIFQLRAKQCVACRERAHGAV
LRPCQHHVLCEPCAATAPECPYCKGQPLQW
Download sequence
Identical sequences ENSGGOP00000014557 ENSGGOP00000025433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]