SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025440 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025440
Domain Number 1 Region: 406-562
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.76e-26
Family SPRY domain 0.012
Further Details:      
 
Domain Number 2 Region: 6-75
Classification Level Classification E-value
Superfamily RING/U-box 3.31e-17
Family RING finger domain, C3HC4 0.007
Further Details:      
 
Domain Number 3 Region: 156-219
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000125
Family B-box zinc-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025440   Gene: ENSGGOG00000009236   Transcript: ENSGGOT00000022823
Sequence length 624
Comment pep:known_by_projection chromosome:gorGor3.1:5:7368635:7373006:1 gene:ENSGGOG00000009236 transcript:ENSGGOT00000022823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGSGPFSCPICLEPLREPVTLPCGHNFCLACLGALWPHRGAGGPGGAARCPLCQEPFPD
GLQLRKNHTLSELLQLRQGALAPEPSAPSAPPSAPEPSAPCAPEPWPAGEEPVRCDACPE
GAALPAALSCLSCLASFCPAHLGPHERSPALRGHRLVPPLRRLEESLCPRHLRPLERYCR
AERVCLCEACAAQEHRGHELVPLEQERALQEAEQSKVLSAVEDRMDELGAGIAQSRRTVA
LIKSAAVAERERVSRLFADAAATLQGFQTQVLGFIEEGEAAMLGCSQGDLRRQEEQRSRL
SRVRQNLSQVPEADSVSFLQELLALRLALEDGCGPGPGPPRELSFTKSSQAVRAVRDMLA
VACVNQWEQLRGPGGNEDGPQKLDSEADAEPQDLESTNLLESEAPRDYFLKFAYIVDLDS
DTADKFLQLFGTKGVKRVLCPINYPLSPTRFTHCEQVLGEGALDRGTYYWEVEIIEGWVS
VGVMAEDFSPQEPYDRGRLGRNAHSCCLQWNGRSFSVWFHGLEAPLPHPFSPTVGVCLEY
ADRALAFYAVRDGKMSLLRRLKASRPRRGGIPASPIDPFQSRLDSHFAGLFTHRLKPAFF
LESVDAHLQIGPLKKSCISVLKRR
Download sequence
Identical sequences ENSGGOP00000025440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]